KEGG   Rattus norvegicus (rat): 116509
Entry
116509            CDS       T01003                                 
Symbol
Slc6a9
Name
(RefSeq) sodium- and chloride-dependent glycine transporter 1
  KO
K05038  solute carrier family 6 (neurotransmitter transporter, glycine) member 5/9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    116509 (Slc6a9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    116509 (Slc6a9)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   116509 (Slc6a9)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 116509
NCBI-ProteinID: NP_446270
RGD: 621243
Ensembl: ENSRNOG00000019484
UniProt: P28572
LinkDB
Position
5:131374562..131408733
AA seq 633 aa
MVGKGAKGMLNGAVPSEATKKDQNLTRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRN
GGGAFMFPYFIMLVFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIG
IYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTPDCAGVLDASNLTNGSRPTALSGNLSH
LFNYTLQRTSPSEEYWRLYVLKLSDDIGDFGEVRLPLLGCLGVSWVVVFLCLIRGVKSSG
KVVYFTATFPYVVLTILFVRGVTLEGAFTGIMYYLTPKWDKILEAKVWGDAASQIFYSLG
CAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVA
DHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWI
LQKKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVSIMYIYGH
RNYFQDIQMMLGFPPPLFFQICWRFVSPTIIFFILIFTVIQYRPITYNHYQYPGWAVAIG
FLMALSSVICIPLYALFQLCRTDGDTLLQRLKNATKPSRDWGPALLEHRTGRYAPTTTPS
PEDGFEVQPLHPDKAQIPIVGSNGSSRLQDSRI
NT seq 1902 nt   +upstreamnt  +downstreamnt
atggtaggaaaaggtgccaaagggatgctgaatggtgctgtgcccagcgaggccaccaag
aaggaccagaacctcacacggggcaactggggcaaccagatcgagtttgtactgacgagc
gtgggctatgccgtgggcctgggcaatgtgtggcgtttcccatacctctgctatcgcaac
gggggaggcgccttcatgtttccctacttcatcatgctggtcttctgcggcattcctctc
ttcttcatggagctctccttcggccagtttgcaagccagggctgcctgggggtctggagg
atcagccccatgttcaaaggcgtgggctatggtatgatggtggtgtccacgtacatcggt
atctactacaacgtggtcatctgcatcgccttctactacttcttctcgtccatgacgcat
gtgctgccctgggcttactgcaataatccctggaacacacctgactgtgccggtgtgctg
gatgcttccaatctcaccaatggctcccggcccactgccctgtctggcaacctgtctcac
ctgttcaactacaccttgcaaaggaccagccccagtgaggagtactggaggctgtatgtg
ctgaagctgtcggatgacattggagattttggagaagtgcggcttcctctcctaggctgc
cttggcgtctcctgggtggttgtcttcctctgcctcattcgaggagtcaagtcttcaggg
aaagtggtgtacttcacggccacatttccctatgtggtgctgaccattctgtttgttcgt
ggagtgaccctggaaggagccttcacgggtatcatgtactacctgaccccaaagtgggac
aagatcctggaggccaaggtgtggggggatgcagcctctcagatcttctattccctgggc
tgtgcatggggtggcctcatcaccatggcatcctacaacaaattccacaacaactgctac
cgggacagcgtcatcatcagcatcaccaattgtgctaccagtgtctatgctggcttcgtc
atcttctctatcctaggcttcatggccaatcacctgggtgtggatgtgtctcgggtggca
gaccacgggcccgggctagctttcgtggcttaccccgaggctctcacactgcttcccatc
tccccgctctggtccttgctgtttttcttcatgctcatcctgctgggactcggtactcag
ttctgcctcctggagaccctagtcactgccattgtggatgaggtggggaatgagtggatt
ctgcagaagaagacctacgtgaccttgggtgtggctgtggctggcttcttgctgggtatc
cctcttaccagccaggcgggcatctactggctgctgttgatggacaactacgcagccagc
ttctccttggttgtcatctcctgcatcatgtgcgtgtccatcatgtatatctatgggcac
cggaactacttccaggacattcagatgatgctggggttcccaccgcctctcttcttccag
atctgttggcgttttgtctctcccactatcatctttttcattctcatcttcacggtgatc
cagtaccggccaatcacttacaaccactaccagtacccaggctgggctgtggccatcggc
ttcctcatggctttgtcgtctgtcatctgcatcccattgtacgcattgttccagctctgc
cgcacagatggggacacacttcttcagcgtttgaaaaatgccacaaagccaagcagagac
tggggccctgccctcctggagcaccggactgggcgctatgcccccactacaaccccctct
cctgaagatgggtttgaggttcagccactgcacccggacaaggcccagatccccatcgtg
ggcagtaacggctccagccgcctccaggactcccggatatga

KEGG   Rattus norvegicus (rat): 117100
Entry
117100            CDS       T01003                                 
Symbol
Slc6a7
Name
(RefSeq) sodium-dependent proline transporter
  KO
K05040  solute carrier family 6 (neurotransmitter transporter, L-proline) member 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    117100 (Slc6a7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    117100 (Slc6a7)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   117100 (Slc6a7)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 117100
NCBI-ProteinID: NP_446448
RGD: 620928
Ensembl: ENSRNOG00000018644
UniProt: P28573 A0A0G2JYB6 G3V8F1
LinkDB
Position
18:complement(54448464..54467319)
AA seq 637 aa
MKKLQEAHLRKPVTPDLLMTPSDQGDVDLDVDFAADRGNWTGKLDFLLSCIGYCVGLGNV
WRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFSSLGPLAVWKISPLFKGAGA
AMLLIVGLVAIYYNMIIAYVLFYLFASLTSNLPWEHCGNWWNTERCLEHRGPKDGNGALP
LNLSSTVSPSEEYWSRYVLHIQGSQGIGRPGEIRWNLCLCLLLAWVIVFLCILKGVKSSG
KVVYFTATFPYLILLMLLVRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEAALQIFYSLG
VGFGGLLTFASYNTFHQNIYRDTFIVTLGNAITSILAGFAIFSVLGYMSQELGVPVDQVA
KAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFLETIVTAVTDEFPYYLR
PKKAVFSGLICVAMYLMGLILTTDGGMYWLVLLDDYSASFGLMVVVITTCLAVTRVYGIQ
RFCRDIHMMLGFKPGLYFRACWLFLSPATLLALLVYSIVKYQPSEYGSYRFPAWAELLGI
LMGLLSCLMIPAGMLVAVLREEGSLWERLQQASRPAIDWGPSLEENRTGMYVATLAGSQS
PKPLMVHMRKYGGITSFENTAIEVDREIAEEEEESMM
NT seq 1914 nt   +upstreamnt  +downstreamnt
atgaagaagctccaggaagctcacctccgcaagcctgtcaccccagacctgctgatgact
cccagtgaccagggtgatgtggacctggatgtagactttgcagcagacagaggcaactgg
acgggcaagctggacttcttgctgtcctgcatcggctactgtgtgggcttgggaaatgtc
tggcggtttccctatcgagcctacaccaatggaggcggagccttcctcgtgccctacttc
ctcatgctggccatctgtggcatccccctcttctttcttgagctctccctgggccagttc
tccagcctgggacccctggctgtctggaaaatcagccccctcttcaaaggtgcgggtgca
gccatgctgctcatcgtgggcctggtggccatctactacaacatgatcatcgcctacgtc
ctcttctacctcttcgcctccctcaccagcaacctgccctgggagcattgcggcaactgg
tggaacacagaacgctgcctggagcacagaggccccaaggatggcaacggggcactgcct
cttaacctcagcagcactgtcagccccagtgaggagtactggagccgatatgtcctgcac
attcagggcagccagggcatcggccgacccggggagattcgctggaacctctgcctctgc
ctgctgctggcctgggtcatcgtgtttctctgtatcctgaagggggtgaagtcctcgggc
aaggtggtgtatttcacagccacctttccctacctcatcctgctcatgctcctggttcga
ggagtgacccttcccggggcctggaagggcatccagttctatctcaccccccaattccac
cacctgctgtcttccaaggtgtggattgaagctgctcttcagatcttctactctctagga
gtgggttttgggggtcttctcacctttgcctcctacaacacattccaccagaacatctac
agagacaccttcattgtcactctgggcaatgccatcaccagcatcctggctggttttgct
atcttctcggtgctgggctacatgtcgcaggagctgggtgtgcctgtggaccaagtggcc
aaagcaggccctggcctggcctttgttgtctacccacaggccatgactatgttgcctctg
tcacccttctggtccttcctcttcttcttcatgcttctgactcttggcctcgatagccag
tttgcctttctggaaaccatagtgactgcagtgaccgatgagttcccatactacctacgg
cccaagaaggcagtgttctcaggcctcatctgtgtagccatgtacctgatgggactgatc
ctcaccaccgatggggggatgtactggctggtccttctggatgactacagcgccagcttc
ggactcatggtggtggtgattaccacatgcctcgctgtcacccgggtatacggcatccag
cggttttgtcgtgacatccacatgatgctgggcttcaagccaggactctacttcagggcc
tgctggctgtttttgtctccggccacactcttggccttgctggtgtacagtatcgtcaag
taccagccctcggaatacggtagctatcgcttccccgcctgggccgagctgctaggcatc
ctgatgggcctgctctcctgcctcatgatcccagctggcatgctggtagctgtgcttcga
gaggagggctcgctctgggagcgacttcagcaagccagccgtcctgctatagactggggc
ccatcactggaagagaaccggacgggcatgtatgtggccaccctggctgggagccagtca
ccaaaaccactgatggtacacatgcgaaaatatgggggcatcaccagcttcgagaataca
gccattgaggtggaccgtgagatcgcagaggaggaagaggagtccatgatgtga

KEGG   Rattus norvegicus (rat): 171148
Entry
171148            CDS       T01003                                 
Symbol
Slc6a5
Name
(RefSeq) sodium- and chloride-dependent glycine transporter 2
  KO
K05038  solute carrier family 6 (neurotransmitter transporter, glycine) member 5/9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    171148 (Slc6a5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    171148 (Slc6a5)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   171148 (Slc6a5)
SSDB
Motif
Pfam: SNF DUF999
Other DBs
NCBI-GeneID: 171148
NCBI-ProteinID: NP_976079
RGD: 621824
Ensembl: ENSRNOG00000031662
UniProt: P58295
LinkDB
Position
1:99645389..99697016
AA seq 799 aa
MDCSAPKEMNKPPTNILEATVPGHRDSPRAPRTSPEQDLPAAAPAAAVQPPRVPRSASTG
AQTFQSADARACEAQRPGVGFCKLSSPQAQATSAALRDLSEGHSAQANPPSGAAGAGNAL
HCKIPALRGPEEDENVSVAKGTLEHNNTPPVGWVNMSQSTVVLGTDGIASVLPGSVATTT
IPEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLA
LAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYL
FASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVN
FTSQANKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLPFCLFLAWVIVYASLAKGIKTS
GKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSL
SAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENV
ADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYL
RTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGL
QRFCEDIEMMIGFQPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLG
WLMLACSVIWIPIMFVIKMYLAPGRFIERLKLVCSPQPDWGPFLAQHRGERYKNMIDPLG
TSSLGLKLPVKDLELGTQC
NT seq 2400 nt   +upstreamnt  +downstreamnt
atggattgcagtgctcccaaggaaatgaataaaccaccaaccaacatcttggaggcaacg
gtgccgggccaccgggatagccctcgagcacctaggaccagccctgagcaggatcttcct
gcggcagcccccgcggccgctgtccagccgccacgtgtgcccaggtcggcttccaccggc
gcccaaactttccagtctgcggatgcgagagcctgtgaggcacagcggcctggagtaggg
ttttgtaaacttagcagcccccaggcacaagcgacctctgcggccctccgggacttaagc
gaagggcacagcgcacaggccaatcccccttccggggccgctggggctggcaacgcttta
cactgcaagattccagctctgcgtggcccggaggaggacgagaacgtgagtgtggccaag
ggcacgctggagcacaacaataccccacccgtgggctgggtgaatatgagccagagcaca
gtggtgttgggtaccgatggaatcgcgtcggtgctcccgggcagcgtggccaccactacc
attccggaggacgagcaaggggatgagaataaggccagagggaactggtccagcaaactg
gacttcatcctgtccatggtggggtacgcagtggggctgggtaatgtttggaggtttccc
tacctggccttccagaacgggggaggtgctttcctcatcccttacttgatgatgctggca
ctggctggcttacctatcttcttcctagaggtgtccctgggccagtttgccagccagggt
cctgtgtctgtgtggaaggccatcccagctctgcagggctgtggcattgcgatgctcatc
atctccgtcctcatagccatctactacaacgtcatcatctgctacacgctcttctacctg
tttgcttcttttgtgtctgtgctgccctggggatcctgcaacaacccgtggaacacacca
gaatgcaaagacaaaaccaaacttttactagattcctgtgttatcggtgaccatcccaag
atacagatcaagaactctactttctgcatgactgcctatccgaacttgaccatggttaac
ttcaccagccaggccaataagacatttgtcagcgggagtgaagagtacttcaagtacttt
gtgctgaagatttctgcagggattgaatatcctggtgagatcaggtggcccttgccgttc
tgccttttcctggcctgggtgattgtatatgcatcgctggcaaaaggaattaagacatca
ggaaaagtggtgtacttcacagccaccttcccttatgtcgtcctggtcatcctcctcatt
cgaggggtcaccctgcctggagctggagccggtatctggtacttcatcacacctaagtgg
gagaaactcacggatgccacggtgtggaaggatgcagccactcagattttcttctccctg
tctgcggcctggggagggctcatcactctttcttcttacaacaaattccataacaactgc
tacagggacacgttaattgtaacctgcaccaacagtgccactagcatcttcgctgggttt
gtcatcttctctgtcattggcttcatggccaacgagcgcaaagtcaacattgagaatgtg
gctgaccaagggccaggcattgcatttgtggtttacccagaagccttaaccaggctgcct
ctctctccattctgggccatcatctttttcctgatgcttctcacgcttggacttgacacc
atgtttgctaccatcgagaccattgtgacctccatctcggatgagtttcccaagtatctg
cgcacacacaagcctgtgttcaccctgggctgctgcatctgcttcttcattatgggcttc
ccaatgatcacacagggtggaatctacatgtttcagcttgtggacacctatgctgcctcc
tatgctcttgtcatcattgccatatttgagcttgttggcatctcctatgtgtacggcttg
cagaggttctgtgaagacatcgagatgatgattggattccagcccaacattttctggaag
gtctgctgggcgtttgtcacaccgaccattttaacgtttatcctttgcttcagcttctat
cagtgggagcccatgacctatggctcctaccgctaccctaactggtccatggtgcttgga
tggctgatgctcgcctgctccgtgatctggatcccgattatgttcgtgataaaaatgtat
ctggctcctgggagatttattgagaggctgaagttggtatgctcgccacagccggactgg
ggcccattcttagctcagcaccgcggggaacgctacaagaatatgatcgaccccttggga
acctcgtccctgggactcaagctgccagtgaaggatttggaactgggcacccagtgctag

KEGG   Rattus norvegicus (rat): 171163
Entry
171163            CDS       T01003                                 
Symbol
Slc6a13
Name
(RefSeq) sodium- and chloride-dependent GABA transporter 2
  KO
K05046  solute carrier family 6 (neurotransmitter transporter, GABA) member 13
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    171163 (Slc6a13)
   04721 Synaptic vesicle cycle
    171163 (Slc6a13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    171163 (Slc6a13)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   171163 (Slc6a13)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 171163
NCBI-ProteinID: NP_598307
RGD: 620788
Ensembl: ENSRNOG00000012876
UniProt: P31646
LinkDB
Position
4:154539246..154577784
AA seq 602 aa
MDNRVSGTTSNGETKPVCPVMEKVEEDGTLEREQWTNKMEFVLSVAGEIIGLGNVWRFPY
LCYKNGGGAFFIPYLIFLFTCGIPVFFLETALGQYTNQGGITAWRKICPIFEGIGYASQM
IVSLLNVYYIVVLAWALFYLFSSFTTDLPWGSCSHEWNTENCVEFQKTNNSLNVTSENAT
SPVIEFWERRVLKISDGIQHLGSLRWELVLCLLLAWIICYFCIWKGVKSTGKVVYFTATF
PYLMLVVLLIRGVTLPGAAQGIQFYLYPNITRLWDPQVWMDAGTQIFFSFAICLGCLTAL
GSYNKYHNNCYRDCVALCILNSSTSFVAGFAIFSILGFMSQEQGVPISEVAESGPGLAFI
AYPRAVVMLPFSPLWACCFFFMVVLLGLDSQFVCVESLVTALVDMYPRVFRKKNRREILI
LIVSVVSFFIGLIMLTEGGMYVFQLFDYYAASGMCLLFVAIFESLCVAWVYGASRFYDNI
EDMIGYKPWPLIKYCWLFFTPAVCLATFLFSLIKYTPLTYNKKYTYPWWGDALGWLLALS
SMVCIPAWSIYKLRTLKGPLRERLRQLVCPAEDLPQKSQPELTSPATPMTSLLRLTELES
NC
NT seq 1809 nt   +upstreamnt  +downstreamnt
atggataacagggtctcgggaacgaccagtaatggagagacaaagccagtgtgtccagtc
atggagaaggtggaggaagacggtaccttggaacgggagcaatggaccaacaagatggag
ttcgtactgtcagtggcgggagagatcattggcttaggcaacgtctggaggtttccctat
ctctgctacaagaacgggggaggtgccttctttattccctacctcatcttcctatttacc
tgtggcattcctgtcttcttcctggagacagcgcttggccagtacaccaaccagggaggc
atcacagcctggaggaaaatctgtcccatcttcgagggcatcggctatgcctcacagatg
atcgtcagccttctcaatgtctactacatcgttgtcctggcctgggccctcttctacctc
ttcagcagcttcaccactgacctcccctggggtagctgcagccacgagtggaatacagaa
aactgtgtggagttccagaaaaccaacaattccctgaatgtgacttctgagaatgccaca
tcccctgtcatcgagttctgggagaggcgagtcctgaagatctcagatggcatccagcac
ctggggtccctgcgctgggagctggtcctgtgcctcctgcttgcctggatcatctgctat
ttctgcatctggaaaggggtcaagtccacaggcaaggtggtgtacttcacagctactttc
ccttacctcatgctggtggtcctgttgatccgaggagtaacactgcctggagcagcccag
ggaattcagttttacctgtaccccaacatcacacgtctgtgggatccccaggtgtggatg
gatgcgggcacccagatcttcttctcctttgccatctgcctggggtgcctcacggccctg
ggcagctacaacaagtaccacaacaactgctacagggactgcgtcgccctttgcattctc
aacagcagcaccagcttcgtggccgggtttgccatcttctccatcctgggcttcatgtct
caggagcagggcgtacccatatctgaggttgctgaatcaggccctggcctggcattcatc
gcctaccctcgagctgtggtgatgttacctttctcgcctttgtgggcctgctgtttcttc
ttcatggtggttctcctgggactagacagccagtttgtgtgtgtagaaagcctcgtgaca
gcgctggtggacatgtatccccgggtgttccgtaagaagaaccggagggagattctcatc
ctcatcgtgtctgtcgtctctttcttcatcgggctcattatgctcacagagggcggcatg
tacgtgttccagctcttcgactactatgcggccagtggcatgtgtcttctctttgtggcc
atctttgagtccctctgtgtggcttgggtttacggagccagccgcttctatgacaacatt
gaagatatgattgggtacaagccgtggcctcttatcaaatactgttggctctttttcacg
ccagctgtgtgcctggcaaccttcctgttctccctgatcaaatacacgccactgacctac
aacaagaagtacacatatccatggtggggggatgccctggggtggctcctagctctgtcc
tccatggtctgcattcctgcctggagcatctacaagctcaggactctcaagggcccactc
agagagagacttcgccagctcgtgtgcccggctgaagaccttccccagaagagccaacca
gagctgacttctccagcgacaccgatgacgtccctcctcaggctcacagaactggagtct
aactgctag

KEGG   Rattus norvegicus (rat): 24898
Entry
24898             CDS       T01003                                 
Symbol
Slc6a3
Name
(RefSeq) sodium-dependent dopamine transporter
  KO
K05036  solute carrier family 6 (neurotransmitter transporter, dopamine) member 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04728  Dopaminergic synapse
rno05012  Parkinson disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    24898 (Slc6a3)
   04721 Synaptic vesicle cycle
    24898 (Slc6a3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    24898 (Slc6a3)
   05022 Pathways of neurodegeneration - multiple diseases
    24898 (Slc6a3)
  09165 Substance dependence
   05030 Cocaine addiction
    24898 (Slc6a3)
   05031 Amphetamine addiction
    24898 (Slc6a3)
   05034 Alcoholism
    24898 (Slc6a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    24898 (Slc6a3)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   24898 (Slc6a3)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 24898
NCBI-ProteinID: NP_036826
RGD: 3715
Ensembl: ENSRNOG00000017302
UniProt: P23977
LinkDB
Position
1:complement(29709443..29750413)
AA seq 619 aa
MSKSKCSVGPMSSVVAPAKESNAVGPREVELILVKEQNGVQLTNSTLINPPQTPVEAQER
ETWSKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELAL
GQFNREGAAGVWKICPVLKGVGFTVILISFYVGFFYNVIIAWALHYFFSSFTMDLPWIHC
NNTWNSPNCSDAHASNSSDGLGLNDTFGTTPAAEYFERGVLHLHQSRGIDDLGPPRWQLT
ACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAMDGIRAYLSVD
FYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIITTSINSLTSFSSG
FVVFSFLGYMAQKHNVPIRDVATDGPGLIFIIYPEAIATLPLSSAWAAVFFLMLLTLGID
SAMGGMESVITGLVDEFQLLHRHRELFTLGIVLATFLLSLFCVTNGGIYVFTLLDHFAAG
TSILFGVLIEAIGVAWFYGVQQFSDDIKQMTGQRPNLYWRLCWKLVSPCFLLYVVVVSIV
TFRPPHYGAYIFPDWANALGWIIATSSMAMVPIYATYKFCSLPGSFREKLAYAITPEKDH
QLVDRGEVRQFTLRHWLLL
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgagtaagagcaaatgctccgtgggaccaatgtcttcagtggtggccccggctaaagag
tccaatgctgtgggccccagagaggtggagctcatcctggtcaaggagcagaacggagtg
cagctgaccaactccaccctcatcaacccgccacagacaccagtggaggctcaagagcgg
gagacctggagcaagaaaattgatttcctgctatcagtcatcggctttgctgtggacctg
gccaatgtctggaggtttccctacctgtgctacaaaaatggtggaggtgccttcctggtg
ccctacctgctcttcatggttattgctgggatgcccctcttctacatggagctggctctc
ggacagttcaacagagaaggagctgctggtgtctggaagatctgtcctgtcctgaaaggt
gtgggcttcactgttatcctcatctctttctacgtgggcttcttctacaatgtcatcatc
gcatgggcactgcactacttcttctcctccttcaccatggacctcccatggatccactgc
aacaacacctggaatagccccaactgctccgatgcccatgccagcaactctagcgacggc
ctgggcctcaatgacacctttgggaccacacccgctgctgagtactttgagcgtggcgtg
ctgcaccttcaccagagccgtggcattgatgacctgggccctccacggtggcagctcaca
gcctgcctggtgctggtcattgttctgctctacttcagcctatggaagggagtaaagacc
tcagggaaggtggtgtggatcacagctaccatgccctatgtggtcctcacggccctgctc
ctgcgtggagttacccttcctggagccatggatggcatcagagcatacctcagtgtggac
ttctaccgactctgtgaggcatctgtgtggatcgatgctgccacccaggtgtgcttctcc
ctcggcgttgggtttggagtgctgattgccttctccagttacaataagttcaccaataac
tgctatagagacgcaatcatcaccacctccattaactccctgacaagcttctcctctggc
ttcgtcgtcttctccttcctggggtacatggcacagaagcacaatgtgcccatcagagat
gtggccacagatggacctgggctcatcttcatcatctatcctgaggcgatcgccacactc
ccgctgtcttctgcctgggctgctgtcttcttcctcatgctgctcactctgggtatcgac
agtgcaatggggggcatggagtcagtgatcactgggctcgtcgatgagttccagctgcta
catcggcatcgagagctcttcactcttggcattgtcctggctactttcctgctgtctctc
ttctgcgtcaccaacggtggcatctacgtcttcacactgctggaccactttgcagctggc
acatctatcctctttggcgtgctcattgaagccattggggtggcctggttctacggcgtc
cagcaattcagtgatgacatcaagcaaatgacagggcagcgacccaacctgtactggcgg
ctatgctggaagctggtcagcccctgcttcctcctgtatgtggtcgtggtcagcattgtg
accttcagacccccacactatggggcctacatcttcccagactgggccaatgccctgggc
tggatcatcgccacatcctccatggccatggtgcccatttatgcgacctacaagttctgc
agcctgccggggtccttccgggagaaactggcctatgccatcacacctgagaaagaccat
cagctagtggacagaggggaggtgcgccaattcacgctgcgtcactggctgttgctgtaa

KEGG   Rattus norvegicus (rat): 25550
Entry
25550             CDS       T01003                                 
Symbol
Slc1a1
Name
(RefSeq) excitatory amino acid transporter 3
  KO
K05612  solute carrier family 1 (neuronal/epithelial high affinity glutamate transporter), member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04724  Glutamatergic synapse
rno04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    25550 (Slc1a1)
  09156 Nervous system
   04724 Glutamatergic synapse
    25550 (Slc1a1)
   04721 Synaptic vesicle cycle
    25550 (Slc1a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    25550 (Slc1a1)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   25550 (Slc1a1)
SSDB
Motif
Pfam: SDF
Other DBs
NCBI-GeneID: 25550
NCBI-ProteinID: NP_037164
RGD: 3696
Ensembl: ENSRNOG00000014816
UniProt: P51907
LinkDB
Position
1:226549932..226631925
AA seq 523 aa
MGKPTSSGCDWRRFLRNHWLLLSTVAAVVLGIVVGVLVRGHSELSNLDKFYFAFPGEILM
RMLKLVILPLIISSMITGVAALDSNVSGKIGLRAVVYYFSTTVIAVILGIVLVVSIKPGV
TQKVNEINRTGKTPEVSTVDAMLDLIRNMFPENLVQACFQQYKTKREEVKPASDPGGNQT
EVSVTTAMTTMSENKTKEYKIVGLYSDGINVLGLIIFCLVFGLVIGKMGEKGQILVDFFN
ALSDATMKIVQIIMCYMPIGILFLIAGKIIEVEDWEIFRKLGLYMATVLSGLAIHSLVVL
PLIYFIVVRKNPFRFALGMAQALLTALMISSSSATLPVTFRCAEEKNHVDKRITRFVLPV
GATINMDGTALYEAVAAVFIAQLNGMDLSIGQIITISITATAASIGAAGVPQAGLVTMVI
VLSAVGLPAEDVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKKELEQVDVSSEVNI
VNPFALEPTILDNEDSDTKKSYVNGGFSVDKSDTISFTQTSQF
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggggaagcccacgagctcgggatgcgactggcgccgcttcctgcggaatcactggctg
ctgctctccaccgtggccgccgtggtactgggcatcgtggtaggagtcttggttcgagga
cacagtgagctctcgaatctggataaattctactttgcgtttcctggagaaattctgatg
cggatgctgaagctcgtcattctgccactgattatatccagcatgatcacaggtgtcgct
gcactggattccaacgtatctggaaaaattggtcttcgtgctgtagtatattatttctcc
accaccgtcattgctgtaatcctaggtattgtgttagttgtgagcatcaagcctggtgtc
actcagaaagtgaatgaaatcaacaggacaggcaaaacccctgaagtcagcactgtggac
gccatgttggatctgatcaggaacatgttccctgagaacctggtccaagcctgttttcag
cagtacaaaaccaagcgtgaagaagtgaagcctgccagtgatcctggggggaaccagaca
gaggtgtctgtcaccacggccatgacaacaatgtctgagaacaagacaaaggaatacaaa
atcgtgggcctgtactcagacggcatcaacgtcctgggcctgattatcttctgcctcgtc
tttggacttgtcattggaaaaatgggagaaaaagggcagattctggtggatttcttcaat
gcgttgagtgacgccaccatgaaaatcgttcagatcatcatgtgttacatgccgatcggt
attttgttcctaatcgctgggaagatcatagaagttgaagactgggaaatattccgcaag
ttgggcctttatatggccactgtcctgagtgggcttgcaatccactccctcgtagtgctg
ccactgatctatttcatagtcgtgcggaagaaccctttccgctttgccttgggcatggcg
caggctctcctgacagctctcatgatctcatctagctcggcaacccttccagttacattc
cgctgtgcggaagaaaagaaccacgtggacaagaggatcacaagatttgtgctgcccgtc
ggcgccaccatcaacatggacggcactgcgctctatgaagccgtggcagctgtgttcatt
gcgcagctgaacggcatggacctgagcattgggcagatcatcacgatcagcatcacagcc
accgctgctagcattggagctgccggtgtgccccaggctggcctggtgaccatggtgatc
gtgttgagtgccgtggggctgcctgctgaggacgtcaccctcatcattgccgtcgactgg
ctcctggaccggttcaggaccatggtgaacgttctgggtgatgcgtttgggacgggcatc
gtggagaagctgtccaagaaggagctggagcaggtggatgtctcctctgaagtcaacatt
gtgaacccctttgccttggagcccacaatcctggataatgaagactcagatacgaagaag
tcttacgtcaatgggggcttctcggtagacaaatctgacaccatctcgttcactcagacc
tcgcagttctag

KEGG   Rattus norvegicus (rat): 25553
Entry
25553             CDS       T01003                                 
Symbol
Slc6a4
Name
(RefSeq) sodium-dependent serotonin transporter
  KO
K05037  solute carrier family 6 (neurotransmitter transporter, serotonin) member 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    25553 (Slc6a4)
   04721 Synaptic vesicle cycle
    25553 (Slc6a4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    25553 (Slc6a4)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   25553 (Slc6a4)
SSDB
Motif
Pfam: SNF 5HT_transport_N
Other DBs
NCBI-GeneID: 25553
NCBI-ProteinID: NP_037166
RGD: 3714
Ensembl: ENSRNOG00000003476
UniProt: P31652
LinkDB
Position
10:61824208..61858924
AA seq 630 aa
METTPLNSQKVLSECKDREDCQENGVLQKGVPTTADRAEPSQISNGYSAVPSTSAGDEAS
HSIPAATTTLVAEIRQGERETWGKKMDFLLSVIGYAVDLGNIWRFPYICYQNGGGAFLLP
YTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTII
AWALYYLISSLTDRLPWTSCTNSWNTGNCTNYFAQDNITWTLHSTSPAEEFYLRHVLQIH
QSKGLQDLGTISWQLTLCIVLIFTVIYFSIWKGVKTSGKVVWVTATFPYIVLSVLLVRGA
TLPGAWRGVVFYLKPNWQKLLETGVWVDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQD
ALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS
TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHIWAKRREWFVLIVVITCVLGSLLT
LTSGGAYVVTLLEEYATGPAVLTVALIEAVAVSWFYGITQFCSDVKEMLGFSPGWFWRIC
WVAISPLFLLFIICSFLMSPPQLRLFQYNYPHWSIVLGYCIGMSSVICIPTYIIYRLIST
PGTLKERIIKSITPETPTEIPCGDIRMNAV
NT seq 1893 nt   +upstreamnt  +downstreamnt
atggagaccacacccttgaattctcagaaagtgctgtcagagtgtaaggacagagaggac
tgtcaagaaaatggtgttctacagaagggtgtccccaccacagcggacagggcagagcct
agccaaatatccaatgggtactctgcagtccccagcacaagtgcaggggacgaagcttca
cactcgatcccagctgccaccaccaccctggtggctgagattcgccaaggggagcgggag
acctggggcaagaagatggatttcctcctgtccgtcattggctatgccgtggacctgggc
aacatctggcggtttccttacatatgctaccagaatggcggaggggccttcctcctccct
tataccatcatggccattttcggggggatcccgctcttttacatggagctcgcactgggc
cagtaccaccgaaacgggtgcatttccatatggaggaagatctgcccgattttcaaaggc
attggttacgccatctgcatcatcgccttttacatcgcctcctactacaacaccatcata
gcctgggcgctctactacctcatctcctccctcacggaccggctgccctggactagctgc
acgaactcctggaacactggcaactgcaccaactacttcgcccaggacaacatcacctgg
acgctgcattccacgtcccccgctgaggagttctacttgcgccatgtcctgcagatccac
cagtctaagggactccaggacctgggcaccatcagctggcagctgactctctgcatcgtg
ctcatcttcaccgtaatctactttagcatctggaaaggcgtcaaaacatctggcaaggtg
gtgtgggtgacagccaccttcccatacattgtcctctctgtcctgctggtgaggggggcc
acccttcctggagcctggagaggggtcgtcttctacttgaaacccaactggcagaaactc
ttggagacaggggtgtgggtagatgccgccgctcagatcttcttctctcttggcccgggc
tttggggttctcctggcttttgctagctacaacaagttcaacaacaactgttaccaagat
gccctggtgaccagtgtggtgaactgcatgacaagcttcgtctctggcttcgtcatcttc
acggtgcttggctacatggcggagatgaggaatgaagatgtgtcagaggtggccaaagac
gcaggccccagcctcctcttcatcacgtatgcagaggcaatagccaacatgccagcatcc
acgttctttgccatcatcttcttcctcatgttaatcacgctgggattggacagcacgttc
gcaggcctggaaggtgtgatcacagctgtgctggatgagttccctcacatctgggccaag
cgcagggaatggttcgtgctcatcgtggtcatcacgtgcgtcttgggatccctgctcaca
ctgacgtcaggaggggcatacgtggtgactctgctggaggagtatgccacggggccagca
gtgctcaccgtggccctcatcgaggccgtcgccgtgtcttggttctatggaatcactcag
ttctgcagcgatgtgaaggagatgctgggcttcagcccgggatggttttggaggatctgc
tgggtggccatcagccctctgtttctcctgttcatcatttgcagttttctgatgagccca
ccccagctacggcttttccaatacaactatccccactggagtatcgtcttgggctactgc
atagggatgtcgtccgtcatctgcatccctacctatatcatttatcggctgatcagcact
ccggggacacttaaggagcgcattattaaaagtatcactcctgaaacacccacagaaatc
ccgtgtggggacatccgcatgaatgctgtgtaa

KEGG   Rattus norvegicus (rat): 29482
Entry
29482             CDS       T01003                                 
Symbol
Slc1a2
Name
(RefSeq) excitatory amino acid transporter 2 isoform a
  KO
K05613  solute carrier family 1 (glial high affinity glutamate transporter), member 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04724  Glutamatergic synapse
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    29482 (Slc1a2)
   04721 Synaptic vesicle cycle
    29482 (Slc1a2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    29482 (Slc1a2)
   05016 Huntington disease
    29482 (Slc1a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    29482 (Slc1a2)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   29482 (Slc1a2)
SSDB
Motif
Pfam: SDF
Other DBs
NCBI-GeneID: 29482
NCBI-ProteinID: NP_058911
RGD: 3697
Ensembl: ENSRNOG00000005479
UniProt: P31596 Q8K5B5
LinkDB
Position
3:89005129..89126498
AA seq 573 aa
MASTEGANNMPKQVEVRMHDSHLSSEEPKHRNLGMRMCDKLGKNLLLSLTVFGVILGAVC
GGLLRLAAPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRA
MVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENL
VQACFQQIQTVTKKVLVAPPSEEANTTKAVISLLNETMNEAPEETKIVIKKGLEFKDGMN
VLGLIGFFIAFGIAMGKMGEQAKLMVEFFNILNEIVMKLVIMIMWYSPLGIACLICGKII
AIKDLEVVARQLGMYMITVIVGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALGT
ASSAGTLPVTFRCLEDNLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVILD
GGQIVTVSLTATLASIGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSV
NVVGDSFGAGIVYHLSKSELDTIDSQHRMHEDIEMTKTQSIYDDTKNHRESNSNQCVYAA
HNSVVIDECKVTLAANGKSADCSVEEEPWKREK
NT seq 1722 nt   +upstreamnt  +downstreamnt
atggcatcaaccgagggtgccaacaatatgcccaagcaggtggaagtgcgcatgcacgac
agccacctcagctccgaggagccaaagcaccgaaacctgggcatgcgcatgtgcgacaag
ctggggaagaacctcctgctctcactgactgtgtttggtgtcatcctgggagcagtatgt
ggcgggctgcttcgcttggcggctcccatccaccctgatgtggtcatgttgatagccttc
ccgggggacatcctcatgaggatgctgaagatgctcatcctccctctcatcatttccagt
ctcatcacagggctgtcagggctggatgctaaagccagcggccgcctaggcacgagagcc
atggtatattacatgtccacgaccatcattgccgctgtgctgggggtcatcctggtgttg
gccatccaccctgggaatcccaaactcaagaagcagctggggcctgggaagaagaacgac
gaggtgtccagcctggatgccttcctggatctcattagaaatctcttcccggagaacctg
gtacaagcctgtttccaacagattcagactgtgacaaagaaagttctggtggcacctcca
tccgaggaggccaatacaaccaaggcagtcatctccctgttgaatgagaccatgaatgag
gcccctgaagaaactaagatcgttatcaagaagggcctggagttcaaggacgggatgaat
gtcttaggtctgattggattctttattgctttcggcattgccatggggaagatgggtgag
caggccaagctgatggtggagttcttcaacattctgaacgagattgtcatgaagttagtg
atcatgatcatgtggtattccccgctgggtatcgcctgcttgatctgtgggaagatcatc
gccatcaaggacttagaagtggttgctaggcagctggggatgtacatgatcacagtgatc
gtgggcctcatcattcatgggggcatctttctccccttgatttactttgtagtgaccaga
aaaaacccattctccttttttgctggcattttccaagcctggatcactgccctgggaacc
gcttccagtgctggaactttgcctgtcaccttccgttgcttggaagataatctagggatt
gacaagcgtgtgaccagattcgtcctcccagtcggagcaaccattaacatggatggtaca
gccctttacgaagccgtggcagccatcttcatagcccagatgaatggggtcatcctggat
ggaggtcagatagtgactgtaagccttacagcaactctggcgagcattggtgcagccagt
attcccagcgccgggttggtcaccatgctcctcattctcacagctgtgggcctgccgaca
gaggacatcagtctgctggtggcagtggactggctgctggatagaatgagaacttcggtc
aatgtagtgggcgattcttttggggctgggattgtctatcacctttccaagtccgagctg
gacaccattgactcccaacaccgaatgcacgaagacatcgaaatgaccaagacgcagtcc
atttatgacgacacgaagaaccacagggaaagcaactctaatcagtgtgtctatgccgca
cacaactctgtcgtaatagatgagtgcaaggtaactctggcggccaatggaaagtcagct
gactgcagtgttgaggaagaaccttggaaacgtgaaaaataa

KEGG   Rattus norvegicus (rat): 29483
Entry
29483             CDS       T01003                                 
Symbol
Slc1a3
Name
(RefSeq) excitatory amino acid transporter 1 isoform 1
  KO
K05614  solute carrier family 1 (glial high affinity glutamate transporter), member 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04724  Glutamatergic synapse
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    29483 (Slc1a3)
   04721 Synaptic vesicle cycle
    29483 (Slc1a3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    29483 (Slc1a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    29483 (Slc1a3)
   04147 Exosome [BR:rno04147]
    29483 (Slc1a3)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   29483 (Slc1a3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of cortical neuronal cells
   29483 (Slc1a3)
SSDB
Motif
Pfam: SDF Yip1 MT
Other DBs
NCBI-GeneID: 29483
NCBI-ProteinID: NP_062098
RGD: 3698
Ensembl: ENSRNOG00000016163
UniProt: P24942 G3V846
LinkDB
Position
2:complement(57755495..57830605)
AA seq 543 aa
MTKSNGEEPRMGSRMERFQQGVRKRTLLAKKKVQNITKEDVKSYLFRNAFVLLTVSAVIV
GTILGFALRPYKMSYREVKYFSFPGELLMRMLQMLVLPLIISSLVTGMAALDSKASGKMG
MRAVVYYMTTTIIAVVIGIIIVIIIHPGKGTKENMYREGKIVQVTAADAFLDLIRNMFPP
NLVEACFKQFKTSYEKRSFKVPIQANETLLGAVINNVSEAMETLTRIREEMVPVPGSVNG
VNALGLVVFSMCFGFVIGNMKEQGQALREFFDSLNEAIMRLVAVIMWYAPLGILFLIAGK
IVEMEDMGVIGGQLAMYTVTVIVGLLIHAVIVLPLLYFLVTRKNPWVFIGGLLQALITAL
GTSSSSATLPITFKCLEENNGVDKRITRFVLPVGATINMDGTALYEALAAIFIAQVNNFD
LNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFLDRLRT
TTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNEPEKPVADSE
TKM
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgacaaaaagcaacggagaagagcccaggatgggaagcaggatggaaagattccagcaa
ggggtgcgcaagcggacgctcctggccaagaagaaagttcagaacatcaccaaggaggat
gtgaagagctacctgtttcggaatgcctttgtgctactcaccgtcagcgctgtcattgtg
ggtacaatccttggatttgccctccgaccgtataaaatgagctaccgggaggtcaagtac
ttctcctttcctggggagcttctgatgcggatgctgcagatgttggtcttacccctgatc
atctccagtcttgtcacaggaatggcggccctagatagtaaggcatctgggaagatgggg
atgcgagctgtggtctattacatgactaccaccatcattgctgtggtgatcggcataatc
attgtcatcatcatccaccccggaaagggcacgaaagaaaacatgtacagagaaggtaaa
atcgtgcaggtgactgccgcagatgccttcctggatttaatcaggaacatgttcccaccc
aatctggtagaagcctgctttaaacagtttaaaaccagctatgagaagagaagctttaaa
gtgcccatccaggccaacgaaacactgttgggcgccgtgatcaacaacgtgtcagaggcc
atggagactctgacccggatccgggaggagatggtacccgttcctgggtctgtgaatggg
gtcaatgccctgggcctcgttgtcttctccatgtgcttcggcttcgtgatcggaaacatg
aaggagcaggggcaagcgctaagagagttcttcgactctctcaatgaagccatcatgaga
ttggtagcggtgataatgtggtatgcacctctgggcatcctcttcttgatcgcagggaag
attgttgagatggaagatatgggtgtgattggggggcagcttgccatgtatacagtgaca
gtcatcgtcggcctcctcattcatgccgtcatcgtcctgcctctcctctacttcctggta
acccggaagaacccctgggttttcattggagggttgctgcaagcactcatcacagccctg
gggacctcctcaagttctgccaccctgcccatcactttcaagtgcctggaagaaaacaat
ggtgtggacaaacgcatcaccagatttgtgcttcccgtgggggccaccattaacatggat
gggaccgccctctacgaggctttggccgccattttcatcgctcaagttaacaactttgac
ctgaattttggacagattataacaataagtatcacagccacagccgcaagcattggggca
gctggcattcctcaggccggtctagtcaccatggtcatcgtgctgacatctgtgggcctg
cccacggatgacatcacactcatcattgcagtggactggtttctggaccgcctccgaacc
accaccaacgtgctgggtgactccctcggggccgggattgttgaacacttgtcccgacat
gaactgaagaaccgagatgttgaaatggggaactccgtgattgaggagaatgaaatgaaa
aagccgtatcagctgattgcccaggacaatgaaccagagaaacccgtggcagacagcgaa
accaagatgtag

KEGG   Rattus norvegicus (rat): 366432
Entry
366432            CDS       T01003                                 
Symbol
Slc1a7
Name
(RefSeq) excitatory amino acid transporter 5
  KO
K05618  solute carrier family 1 (glutamate transporter), member 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    366432 (Slc1a7)
   04721 Synaptic vesicle cycle
    366432 (Slc1a7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    366432 (Slc1a7)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   366432 (Slc1a7)
SSDB
Motif
Pfam: SDF DUF2417
Other DBs
NCBI-GeneID: 366432
NCBI-ProteinID: NP_001102443
RGD: 1311928
Ensembl: ENSRNOG00000011644
UniProt: D3ZT83
LinkDB
Position
5:122731003..122775139
AA seq 570 aa
MEWCQQAGLSMVLGAFLARGRAVCRHNGLLILSVLSVIVGCLLGFFLRTQRLSPQEISYF
QFPGELLMRMLKMLILPLVVSSLMSGLASLDAKTSSRLGILTVAYYLWTTFLAVVVGIIM
VSIIHPGGAAQKETTEQSGKPVMSSADALLDLVRNMFPANLVEATFKQYRTKTTPVIKSP
KGAAEEAPPRGIVIYGVQEDNGSRVQNFALDLTPPPEIVYKSEPGTSDGMNVLGIVIFSA
TMGIMLGRMGDSGTPLVSFCQCLNESVMKIVAVAGWYFPFGIVFLIAGKILEMDDPKAVG
KKLGFYAVTVVCGLVVHGLLILPLLYFLITRKNPIVFIRGVLQALLIALATSSSSATLPI
TFKCLLENNHIDRRIARFVLPVGATINMDGTALYEAVAAIFIAQVNNYELDFGQIITISI
TATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDINLIIAVDWALDRFRTMINVLGDALAA
GIMAHICRKDFAQDMGTEKLLPCETKPVTLQEIVAAQQNGCVKSVAEASELTLGPKCPHH
IPVQVEQDEELATASLDHCTIEINELETNV
NT seq 1713 nt   +upstreamnt  +downstreamnt
atggaatggtgccaacaggctgggctcagcatggtgctgggcgcctttctggctcgaggg
cgggcagtgtgtagacacaacgggctcctcatcctgtctgtgctgtctgtcatcgtgggc
tgcctccttggcttcttcctcaggacccagcgcctctcaccacaggagattagctacttc
cagttccctggagaactcttgatgaggatgctgaagatgctgatcctaccactggtggtc
tccagcttgatgtctggccttgcctccctggatgccaagacctccagccgcttgggcatc
ctcaccgtggcatattacctgtggaccacctttctggctgtcgtcgtgggcatcatcatg
gtctccatcatccaccctggtggtgcagcacagaaggagaccaccgaacagagtggaaag
ccagtcatgagctcagccgatgccctcctggaccttgtccggaacatgtttccagccaac
ctggtagaagccacattcaaacagtaccgcaccaaaaccaccccagttatcaagtctccc
aaaggggctgcggaggaggcccctccccgggggatcgtcatctacggggtccaggaagac
aacggctcacgtgtgcagaactttgccctggacctgacgcccccgcctgagattgtctat
aagtcagagcctggtacgagtgacggcatgaacgtgctaggcatcgtcatcttctcggcc
actatgggcatcatgctgggccgcatgggtgacagcgggacccccctggtcagcttctgt
cagtgccttaatgagtccgtcatgaagatcgtggcagtggcagggtggtacttccccttc
ggcattgtcttcctgatcgctggcaagatcctggagatggatgaccccaaggctgtgggg
aagaagctgggcttctatgccgtgaccgtggtttgtgggctggtggtccacggtctccta
atcctgcccctgctgtatttcctcatcaccaggaagaaccccatcgtcttcatccgtggc
gtcctccaagctctgctcattgcactggccacctcctccagctcagccaccctgcccatc
accttcaagtgtctgctggagaacaaccacatcgaccgacgcatcgctcgctttgtgctg
cccgtgggcgccaccatcaacatggacggcactgcgctctacgaggctgtggctgccatc
tttattgcccaggtcaacaactacgagctagactttggccagatcatcactatcagcatt
acagccactgcagccagcattggggcggctggcatcccgcaggcagggctcgtcaccatg
gtcattgtgctcacctctgtgggactgccgaccgatgacatcaacctcatcatcgctgta
gactgggcactggatcgcttccgaaccatgattaacgtgctgggcgatgcgctggcagca
gggatcatggcccacatctgccggaaggattttgctcaggacatgggcactgagaaattg
ctgccctgtgaaaccaagccagtgacactgcaggagatcgtggctgcccagcagaacggc
tgtgtgaagagtgtggctgaggcctcagagctaaccctgggccccaagtgtccacaccac
atcccggtccaggtagagcaggatgaagagctggccactgccagcctagaccactgcact
atcgagatcaatgagctggagaccaatgtgtga

DBGET integrated database retrieval system