KEGG   Rattus norvegicus (rat): 116544
Entry
116544            CDS       T01003                                 
Symbol
Pou2f3
Name
(RefSeq) POU domain, class 2, transcription factor 3
  KO
K09364  POU domain transcription factor, class 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05168  Herpes simplex virus 1 infection
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    116544 (Pou2f3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    116544 (Pou2f3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    116544 (Pou2f3)
   03021 Transcription machinery [BR:rno03021]
    116544 (Pou2f3)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain POU
    116544 (Pou2f3)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase III system
   Other transcription-related factors
    Octamer transcription factors
     116544 (Pou2f3)
SSDB
Motif
Pfam: Pou Homeodomain Homeobox_KN DUF4424
Other DBs
NCBI-GeneID: 116544
NCBI-ProteinID: NP_001099215
RGD: 621691
Ensembl: ENSRNOG00000009118
UniProt: P42571 G3V754
LinkDB
Position
8:complement(43495408..43577795)
AA seq 430 aa
MVNLEPMHTEIKMSGDVADSTDARSTFGQVESGNDRNGLDFNRQIKTEDLGDTLQQSLSH
RPCHLSQGPTMMPGNQMSGDMASLHPLQQLVLVPGHLQSVSQFLLSQTPPGQQGLQPNLL
SFPQQQSTLLLPQTGPGLTSQAVGRPGLSGSSLEPHLEASQHLPGPKHLPGPGGNDEPTD
LEELEKFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKP
LLEKWLNDAESSPSDPSASTPSSYPTLSEVFGRKRKKRTSIETNIRLTLEKRFQDNPKPS
SEEISMIAEQLSMEKEVVRVWFCNRRQKEKRINCPVATPVKPPIYNSRLVSPSGSLGSLS
VPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAMNPSSAAFNSSGSW
YRWNHPAYLH
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggtgaatctggagcccatgcacacagagatcaagatgagtggggatgtcgctgattcc
acagatgcccgcagcacttttggtcaagtggagtcaggaaatgatcgaaatggcctagat
ttcaacagacagattaagacagaggatctgggtgacactttgcagcagagcctctcccac
aggccatgccacctgagccaagggcctaccatgatgcctggaaaccaaatgtctggggac
atggcttctctccatccacttcagcagcttgtgctggtccctggccacttacagtctgta
tcccagtttctgctttcccagacccctcctgggcagcaaggtctgcagccgaatcttctc
tcctttccacagcaacagagcactctactcctcccacagacaggacctggcctcacctcc
caggcagttggacgccctgggctgtcaggatcctctttagagccccacctggaagcttct
caacatctgccagggcccaagcatctgcctggccccggagggaatgacgaacccactgac
ctggaggagctggagaagttcgccaagaccttcaagcagaggcgcataaagctaggcttc
acacagggggatgtgggattggcgatgggaaagctgtatggtaacgacttcagccagact
accatctcgagatttgaggccctcaacctgagtttcaagaacatgtgtaaactcaagcca
ctgctggagaagtggctgaatgatgcagagtcctccccgtcagacccttcagcaagcact
cccagctcgtaccccactctcagcgaagtatttggcaggaagaggaagaaacggaccagc
atcgagaccaacatccgcctgactttggagaagcgatttcaagataaccctaaacccagc
tcggaagagatttccatgattgcggagcagttgtccatggagaaggaagtggtaagagtc
tggttctgcaatcgacgccaaaaggagaagagaatcaactgccctgtggccacacctgtc
aagccgcccatctacaactcccggctggtctctccctcagggtctctgggctccctctca
gtccctcctgtccacagcaccatgcctggaacagtaacgtcatcctgttcccctgggaac
aacagcaggccctcgtctcccggctcaggactccatgccagcagccccacggcatctcaa
aataactccaaagcagcaatgaacccctcctccgccgcctttaactcctcagggtcatgg
taccgttggaaccatcccgcctacctccactga

KEGG   Rattus norvegicus (rat): 117058
Entry
117058            CDS       T01003                                 
Symbol
Pou2f2
Name
(RefSeq) POU domain, class 2, transcription factor 2
  KO
K09364  POU domain transcription factor, class 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05168  Herpes simplex virus 1 infection
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    117058 (Pou2f2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    117058 (Pou2f2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    117058 (Pou2f2)
   03021 Transcription machinery [BR:rno03021]
    117058 (Pou2f2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain POU
    117058 (Pou2f2)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase III system
   Other transcription-related factors
    Octamer transcription factors
     117058 (Pou2f2)
SSDB
Motif
Pfam: Pou Homeodomain
Other DBs
NCBI-GeneID: 117058
NCBI-ProteinID: NP_001258133
RGD: 621690
Ensembl: ENSRNOG00000055650
LinkDB
Position
1:complement(80682330..80769756)
AA seq 463 aa
MVHSSMGAPEIRMSKPLEAEKQSLDSPSEHTDTERNGPDINHQNPQNKASPFSVSPTGPS
TKIKAEDPSGDSAPAAPPPPQPAQPHLPQAQLMLTGSQLAGDIQQLLQLQQLVLVPGHHL
QPPAQFLLPQAQQSQPGLLPTPNLFQLPQQTQGALLTSQPRAGLPTQPSKCLEPPSHPEE
PSDLEELEQFARTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCK
LKPLLEKWLNDAETMSVDSSLPSPNQLSSPSLGFDGLPGRRRKKRTSIETNVRFALEKSF
LANQKPTSEEILLIAEQLHMEKEVIRVWFCNRRQKEKRINPCSAAPMLPSPGKPTSYSPH
LVTPQGGAGTLPLSQASSSLSTTVTTLSSAVGTLHPSRTAGGGGGGGGAAPPLNSIPSVT
PPPPATTNSTNPSPQGSHSAIGLTGLNPSAGPGLWWNPAPYQP
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggttcactccagcatgggggctccagaaataagaatgtctaagcccctggaggccgag
aagcaaagtctggactccccgtcagagcacacagacactgaaagaaatggacccgacatt
aaccatcagaacccccagaacaaagcgtccccattctctgtgtccccaactggccccagc
accaagatcaaggctgaagaccccagtggtgattcagccccagcagcacccccgcccccc
cagccggctcagcctcatctgccccaggcccaactcatgttgacgggcagccagctagct
ggggacatacagcaactcctccagctccaacagctggtgcttgtccccggccaccacctc
cagccacctgctcagttcctgctgccacaagcgcagcagagtcagccagggctgctacca
acgccaaatctattccagctacctcagcaaacccagggagctctcctgacctcccagccc
cgggctgggcttcctacacagccctcgaaatgcttggagccaccatcccacccggaggag
cccagtgatctggaggagctggaacagttcgctcgcaccttcaagcaacgccgcatcaag
ctgggcttcacacagggtgatgtgggcctggccatgggcaagctctatggcaacgacttc
agccaaacgaccatttcccgcttcgaggcccttaacctgagcttcaagaacatgtgtaaa
ctcaagcccctcctggagaagtggctcaacgacgcagagactatgtctgtggattcaagc
ctacccagcccaaaccagctgagcagccccagcctgggtttcgacgggctgccggggcgg
agacgcaagaagaggaccagcatcgagacgaatgtccgcttcgccttagagaagagtttc
ctagcgaaccagaagcctacctcagaggagatcctgctgattgcagagcagctgcacatg
gaaaaggaagtgatccgcgtctggttctgcaaccggcgccagaaggagaaacgcatcaac
ccttgcagtgcggcccccatgctgcccagcccgggaaagccgaccagttacagcccgcac
ctggtcacaccccaagggggcgcaggaaccttaccattgtcccaagcttctagcagtctg
agcacaacagttactaccttatcctcagctgtggggacactccaccccagccggacagca
ggagggggtggcggtgggggcggagccgcgccccccctcaattccatcccctctgtcact
cccccacccccggccaccaccaacagcacaaacccgagccctcaaggcagccactcggct
atcggcttgacgggcctgaaccccagcgcaggccctggcctctggtggaaccctgcccct
taccagccttga

KEGG   Rattus norvegicus (rat): 171068
Entry
171068            CDS       T01003                                 
Symbol
Pou2f1
Name
(RefSeq) POU domain, class 2, transcription factor 1
  KO
K09364  POU domain transcription factor, class 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05168  Herpes simplex virus 1 infection
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    171068 (Pou2f1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    171068 (Pou2f1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    171068 (Pou2f1)
   03021 Transcription machinery [BR:rno03021]
    171068 (Pou2f1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain POU
    171068 (Pou2f1)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase III system
   Other transcription-related factors
    Octamer transcription factors
     171068 (Pou2f1)
SSDB
Motif
Pfam: POU2F1_C Pou Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 171068
NCBI-ProteinID: NP_001094109
RGD: 621689
Ensembl: ENSRNOG00000003581
UniProt: P31503 F1LRD7
LinkDB
Position
13:complement(78120617..78263306)
AA seq 768 aa
MADGGAASQDESSAAAAAAADSRMNNPSETNKSSMESGDASTGTQTNGLDFEKQPVPVGG
AISTAQAQAFLGHLHQVQLAGTSLQAAAQSLNVQSKSSEESGDSQQSSQPSQQPSVQSAI
PQTQLMLAGGQITGLTLTPAQQQLLLQQAQAQAQLLAAAVQQHSASQQHSAAGATISASA
ATPMTQIPLSQPIQIAQDLQQLQQLQQQNLNLQQFVLVHPTTNLQPAQFIISQTPQGQQG
LLQAQNLLTQLPQQSQANLLQPQPSITLTSQPTTPTRTIAATPIQTLPQSQTTPKRIDTP
SLEEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFK
NMCKLKPLLEKWLNDAENLSSDSTASSPSALNSPGLGAEGLNRRRKKRTSIETNIRVALE
KSFMENQKPTSEDITLIAEQLNMEKEVIRVWFCNRRQKEKRINPPSSGGTSSSPIKAIFP
SPTSLVATTPSLVTSSTATTLTVNPVLPLTSAAMTNLSLTGTTDSTSNNTATVISTAPPA
SSAVTSPSLSPSPSASASTSEASSASETSTTQTTSTPLPSPLGASQVMVTASGLQTAAAA
ALQGAAQLPANASLAAMAAAAGLNPGLMAPSQFAAGGALLSLNPGTLGGALSPALMSNST
LATIQALASSGSLPITSLDATGNLVFANAGGAPNIVTAPLFLNPQNLSLLTSNPVSLVSA
AAASTGNSAPTASLHASSTSTESIQNSLFTVASASGAASTTTAASKAQ
NT seq 2307 nt   +upstreamnt  +downstreamnt
atggcggacggaggagcagcgagtcaagatgagagttcagccgcggcggcagcagcagca
gactcaagaatgaacaatccgtcagaaaccaataagtcatctatggagagtggagatgcc
agcacaggcacacagaccaatggcctggactttgagaagcagcccgtgcctgtcggaggg
gccatctccacagcccaggcccaggctttccttgggcatcttcaccaggtccagctcgct
gggacaagtttacaggctgctgctcaatctttaaatgtacagtctaaatctagtgaagag
tccggagattcgcagcagtcaagccagccttcccagcagccttcagtgcagtcagccatt
ccccagactcagctaatgctggccgggggacagataactgggctcacactgacaccagcc
cagcaacagcttttactacagcaggcccaggcccaggcccagctcctggctgctgcagtg
cagcaacactccgccagccaacagcacagtgctgctggggccaccatctcagcctccgct
gccacacccatgacgcagatccccctgtctcagcccatacagattgcacaggatcttcaa
caattgcaacagcttcagcagcaaaatctcaacttgcaacagttcgtcttggtgcaccca
accaccaacttgcaaccagcacagtttatcatctctcagaccccccagggccagcagggt
ctcctgcaagcgcaaaatcttttaacgcaactacctcagcaaagccaagccaacctccta
cagccacagccaagcatcaccctcacgtcccagcctaccaccccaactcgcacaatagca
gcaaccccaattcagacacttccacagagccagacaacaccaaagcgaattgatactccc
agcttggaggagcccagtgaccttgaggagcttgagcaatttgccaagacttttaaacaa
agacgaatcaaacttggattcactcagggtgatgttgggcttgctatggggaaattatat
ggaaatgacttcagccaaaccaccatctctcgctttgaagccttgaacctcagctttaag
aacatgtgcaagttaaagccccttttagagaagtggctaaatgacgcggagaacctctca
tctgattctacagcatctagcccaagtgctttgaattctccagggttgggggctgagggc
ttgaatcgtaggaggaaaaaacgcaccagcatagagaccaacatccgtgtggccttagaa
aagagtttcatggagaatcaaaagcctacctcggaagatatcaccttgattgctgaacag
ctcaatatggagaaggaggtgattcgtgtttggttttgtaaccgccgccagaaggagaaa
agaatcaacccgccaagcagtggtgggaccagcagctcaccaatcaaagcaattttcccc
agcccaacctcactggtggcaaccactccaagccttgtgacaagcagtacagcaactacc
ctcacagtcaaccctgtgctccccttaaccagtgctgccatgactaatctttctcttaca
ggcactacagactccacgtccaacaacacggccaccgtgatttccacagcaccccctgct
tcctcagcagtcacatctccctccttgagtccctctccttctgcctcagcctccacctct
gaggcctctagtgccagcgagaccagcacaacacagaccacctccacacctctcccctcc
cctcttggagccagccaggtgatggtgacagcctctggcttacagactgcagccgccgct
gctctccaaggagctgcacagttgccagcaaatgccagtcttgctgctatggctgctgct
gcaggactcaatccaggcctgatggcaccctcacagtttgctgctggaggtgccttactc
agtctcaatccggggaccctgggtggggctctcagcccggccctgatgagcaacagtaca
ctggcaaccattcaagctcttgcttctagtggctctcttccaataacatctctggatgca
actgggaacctggtattcgccaatgcaggaggagcccccaacatcgtgactgcccctctg
ttcctgaaccctcagaacctctctctgctcaccagcaacccagtaagcttggtttctgcc
gctgcagcctccacagggaactccgcacctacagccagccttcatgcctcctccacctca
actgagtccatccagaactctctgttcacagtggcctctgccagcggggctgcctccacc
accacagctgcctccaaggcacagtga

DBGET integrated database retrieval system