KEGG   Rattus norvegicus (rat): 116554
Entry
116554            CDS       T01003                                 

Gene name
Mapk8
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04024  cAMP signaling pathway
rno04068  FoxO signaling pathway
rno04071  Sphingolipid signaling pathway
rno04137  Mitophagy - animal
rno04140  Autophagy - animal
rno04141  Protein processing in endoplasmic reticulum
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04217  Necroptosis
rno04310  Wnt signaling pathway
rno04380  Osteoclast differentiation
rno04510  Focal adhesion
rno04530  Tight junction
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04668  TNF signaling pathway
rno04722  Neurotrophin signaling pathway
rno04723  Retrograde endocannabinoid signaling
rno04728  Dopaminergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04910  Insulin signaling pathway
rno04912  GnRH signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04917  Prolactin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04926  Relaxin signaling pathway
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04935  Growth hormone synthesis, secretion and action
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05133  Pertussis
rno05135  Yersinia infection
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05162  Measles
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05231  Choline metabolism in cancer
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    116554 (Mapk8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    116554 (Mapk8)
   04012 ErbB signaling pathway
    116554 (Mapk8)
   04014 Ras signaling pathway
    116554 (Mapk8)
   04310 Wnt signaling pathway
    116554 (Mapk8)
   04668 TNF signaling pathway
    116554 (Mapk8)
   04068 FoxO signaling pathway
    116554 (Mapk8)
   04071 Sphingolipid signaling pathway
    116554 (Mapk8)
   04024 cAMP signaling pathway
    116554 (Mapk8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    116554 (Mapk8)
   04137 Mitophagy - animal
    116554 (Mapk8)
  09143 Cell growth and death
   04210 Apoptosis
    116554 (Mapk8)
   04215 Apoptosis - multiple species
    116554 (Mapk8)
   04217 Necroptosis
    116554 (Mapk8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    116554 (Mapk8)
   04530 Tight junction
    116554 (Mapk8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    116554 (Mapk8)
   04621 NOD-like receptor signaling pathway
    116554 (Mapk8)
   04622 RIG-I-like receptor signaling pathway
    116554 (Mapk8)
   04625 C-type lectin receptor signaling pathway
    116554 (Mapk8)
   04660 T cell receptor signaling pathway
    116554 (Mapk8)
   04658 Th1 and Th2 cell differentiation
    116554 (Mapk8)
   04659 Th17 cell differentiation
    116554 (Mapk8)
   04657 IL-17 signaling pathway
    116554 (Mapk8)
   04664 Fc epsilon RI signaling pathway
    116554 (Mapk8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    116554 (Mapk8)
   04920 Adipocytokine signaling pathway
    116554 (Mapk8)
   04912 GnRH signaling pathway
    116554 (Mapk8)
   04914 Progesterone-mediated oocyte maturation
    116554 (Mapk8)
   04917 Prolactin signaling pathway
    116554 (Mapk8)
   04926 Relaxin signaling pathway
    116554 (Mapk8)
   04935 Growth hormone synthesis, secretion and action
    116554 (Mapk8)
  09156 Nervous system
   04728 Dopaminergic synapse
    116554 (Mapk8)
   04723 Retrograde endocannabinoid signaling
    116554 (Mapk8)
   04722 Neurotrophin signaling pathway
    116554 (Mapk8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    116554 (Mapk8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    116554 (Mapk8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    116554 (Mapk8)
   05231 Choline metabolism in cancer
    116554 (Mapk8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    116554 (Mapk8)
   05212 Pancreatic cancer
    116554 (Mapk8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    116554 (Mapk8)
   05170 Human immunodeficiency virus 1 infection
    116554 (Mapk8)
   05161 Hepatitis B
    116554 (Mapk8)
   05171 Coronavirus disease - COVID-19
    116554 (Mapk8)
   05162 Measles
    116554 (Mapk8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    116554 (Mapk8)
   05169 Epstein-Barr virus infection
    116554 (Mapk8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    116554 (Mapk8)
   05135 Yersinia infection
    116554 (Mapk8)
   05133 Pertussis
    116554 (Mapk8)
   05152 Tuberculosis
    116554 (Mapk8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    116554 (Mapk8)
   05142 Chagas disease
    116554 (Mapk8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    116554 (Mapk8)
   05012 Parkinson disease
    116554 (Mapk8)
   05016 Huntington disease
    116554 (Mapk8)
   05017 Spinocerebellar ataxia
    116554 (Mapk8)
   05020 Prion disease
    116554 (Mapk8)
   05022 Pathways of neurodegeneration - multiple diseases
    116554 (Mapk8)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    116554 (Mapk8)
   05418 Fluid shear stress and atherosclerosis
    116554 (Mapk8)
   05415 Diabetic cardiomyopathy
    116554 (Mapk8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    116554 (Mapk8)
   04932 Non-alcoholic fatty liver disease
    116554 (Mapk8)
   04931 Insulin resistance
    116554 (Mapk8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    116554 (Mapk8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    116554 (Mapk8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    116554 (Mapk8)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     116554 (Mapk8)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   116554 (Mapk8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo ABC1 Kinase-like RIO1 APH FTA2 DUF530 TCAD9
Other DBs
NCBI-GeneID: 116554
NCBI-ProteinID: NP_446281
RGD: 621506
Ensembl: ENSRNOG00000020155
UniProt: P49185
LinkDB
Position
16
AA seq 427 aa
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCLKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPVSSPSVNDMSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagtaaacgtgacaacaatttttatagtgtagagatcggagattctacattc
acagtcctaaaacgataccagaacttaaagcctataggctcaggagctcaaggaatagtg
tgtgcagcttatgatgctattcttgaaagaaatgttgcaatcaagaagctcagccggcca
tttcagaatcagacccatgctaagcgagcctaccgagaactagttcttatgaagtgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggagttagatcatgaaagaatgtcctaccttctctatcaaatgctgtgtggaatcaag
caccttcactctgctggaattattcatcgggacttaaagcctagtaatatagtagtcaaa
tcagactgcactttgaagattcttgattttggactggcaaggactgcaggaacgagtttt
atgatgacgccttacgtggtaactcgttactacagagcaccagaggtcattctcggcatg
ggctacaaggagaacgtggatttatggtctgtggggtgcattatgggagaaatggtttgc
ctcaaaatcctctttccaggaagggactatattgatcagtggaataaagttattgaacag
ctcggaacaccttgtcctgaattcatgaagaaactacaaccaacagtaaggacttacgtt
gaaaacagacctaagtacgctggctatagctttgagaaactgtttcctgatgtgcttttc
ccagctgactcagaacataacaaacttaaagccagtcaggcgagagatttgttatctaaa
atgctggtgatagatgcgtccaaaaggatctccgtagacgaagctctccagcacccgtac
atcaacgtctggtatgatccttcagaagcagaggccccaccaccaaagatccctgacaag
cagttagatgaaagggagcacacaatagaggagtggaaagaactgatatacaaggaggtc
atggatttggaggagcgaactaagaatggcgtcataagagggcagccgtctcctttaggt
gcagcagtgatcaatggctctcagcatccggtctcttcgccgtctgtcaatgacatgtct
tcaatgtccacagatccgactctggcctcggatacagacagcagtctagaagcatcagct
ggacctctgggctgctgtagatga

KEGG   Rattus norvegicus (rat): 25272
Entry
25272             CDS       T01003                                 

Gene name
Mapk10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform 2
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04024  cAMP signaling pathway
rno04068  FoxO signaling pathway
rno04071  Sphingolipid signaling pathway
rno04137  Mitophagy - animal
rno04140  Autophagy - animal
rno04141  Protein processing in endoplasmic reticulum
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04217  Necroptosis
rno04310  Wnt signaling pathway
rno04380  Osteoclast differentiation
rno04510  Focal adhesion
rno04530  Tight junction
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04668  TNF signaling pathway
rno04722  Neurotrophin signaling pathway
rno04723  Retrograde endocannabinoid signaling
rno04728  Dopaminergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04910  Insulin signaling pathway
rno04912  GnRH signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04917  Prolactin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04926  Relaxin signaling pathway
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04935  Growth hormone synthesis, secretion and action
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05133  Pertussis
rno05135  Yersinia infection
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05162  Measles
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05231  Choline metabolism in cancer
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    25272 (Mapk10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    25272 (Mapk10)
   04012 ErbB signaling pathway
    25272 (Mapk10)
   04014 Ras signaling pathway
    25272 (Mapk10)
   04310 Wnt signaling pathway
    25272 (Mapk10)
   04668 TNF signaling pathway
    25272 (Mapk10)
   04068 FoxO signaling pathway
    25272 (Mapk10)
   04071 Sphingolipid signaling pathway
    25272 (Mapk10)
   04024 cAMP signaling pathway
    25272 (Mapk10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    25272 (Mapk10)
   04137 Mitophagy - animal
    25272 (Mapk10)
  09143 Cell growth and death
   04210 Apoptosis
    25272 (Mapk10)
   04215 Apoptosis - multiple species
    25272 (Mapk10)
   04217 Necroptosis
    25272 (Mapk10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25272 (Mapk10)
   04530 Tight junction
    25272 (Mapk10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    25272 (Mapk10)
   04621 NOD-like receptor signaling pathway
    25272 (Mapk10)
   04622 RIG-I-like receptor signaling pathway
    25272 (Mapk10)
   04625 C-type lectin receptor signaling pathway
    25272 (Mapk10)
   04660 T cell receptor signaling pathway
    25272 (Mapk10)
   04658 Th1 and Th2 cell differentiation
    25272 (Mapk10)
   04659 Th17 cell differentiation
    25272 (Mapk10)
   04657 IL-17 signaling pathway
    25272 (Mapk10)
   04664 Fc epsilon RI signaling pathway
    25272 (Mapk10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    25272 (Mapk10)
   04920 Adipocytokine signaling pathway
    25272 (Mapk10)
   04912 GnRH signaling pathway
    25272 (Mapk10)
   04914 Progesterone-mediated oocyte maturation
    25272 (Mapk10)
   04917 Prolactin signaling pathway
    25272 (Mapk10)
   04926 Relaxin signaling pathway
    25272 (Mapk10)
   04935 Growth hormone synthesis, secretion and action
    25272 (Mapk10)
  09156 Nervous system
   04728 Dopaminergic synapse
    25272 (Mapk10)
   04723 Retrograde endocannabinoid signaling
    25272 (Mapk10)
   04722 Neurotrophin signaling pathway
    25272 (Mapk10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    25272 (Mapk10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    25272 (Mapk10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25272 (Mapk10)
   05231 Choline metabolism in cancer
    25272 (Mapk10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    25272 (Mapk10)
   05212 Pancreatic cancer
    25272 (Mapk10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    25272 (Mapk10)
   05170 Human immunodeficiency virus 1 infection
    25272 (Mapk10)
   05161 Hepatitis B
    25272 (Mapk10)
   05171 Coronavirus disease - COVID-19
    25272 (Mapk10)
   05162 Measles
    25272 (Mapk10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    25272 (Mapk10)
   05169 Epstein-Barr virus infection
    25272 (Mapk10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    25272 (Mapk10)
   05135 Yersinia infection
    25272 (Mapk10)
   05133 Pertussis
    25272 (Mapk10)
   05152 Tuberculosis
    25272 (Mapk10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    25272 (Mapk10)
   05142 Chagas disease
    25272 (Mapk10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    25272 (Mapk10)
   05012 Parkinson disease
    25272 (Mapk10)
   05016 Huntington disease
    25272 (Mapk10)
   05017 Spinocerebellar ataxia
    25272 (Mapk10)
   05020 Prion disease
    25272 (Mapk10)
   05022 Pathways of neurodegeneration - multiple diseases
    25272 (Mapk10)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    25272 (Mapk10)
   05418 Fluid shear stress and atherosclerosis
    25272 (Mapk10)
   05415 Diabetic cardiomyopathy
    25272 (Mapk10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    25272 (Mapk10)
   04932 Non-alcoholic fatty liver disease
    25272 (Mapk10)
   04931 Insulin resistance
    25272 (Mapk10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    25272 (Mapk10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    25272 (Mapk10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25272 (Mapk10)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     25272 (Mapk10)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   25272 (Mapk10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo ABC1 Kinase-like RIO1 APH FTA2 TCAD9
Other DBs
NCBI-GeneID: 25272
NCBI-ProteinID: NP_036938
RGD: 3663
Ensembl: ENSRNOG00000002079
Vega: OTTRNOG00000002125
UniProt: P49187
LinkDB
Position
14
AA seq 426 aa
MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSK
MLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEV
MNSEEKTKNGVVKGQPSPSGAAVNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAG
PLGCCR
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgagcaaaagcaaggtagataaccagttctacagtgtggaagtgggagactcaaccttc
acagttctaaagcgctaccagaacctgaagccgatcggctctggggctcagggaatagtt
tgtgctgcgtatgacgctgtcctcgacagaaatgtggccattaagaagctcagcagaccc
ttccagaaccaaactcatgccaagagggcttaccgggagctggtcctcatgaagtgtgtg
aaccataaaaacattattagcttattaaatgtctttacaccccagaaaacactggaggag
ttccaagatgtttacttagtgatggaactgatggacgccaacttgtgtcaggtgattcag
atggagctggaccacgagcggatgtcgtacttgctgtaccagatgctgtgcggcatcaaa
cacctccactccgctgggatcatccacagggacttaaaacccagtaacatcgtagtcaag
tctgattgcacactgaaaatcctggactttggactggccaggacagcgggcacaagcttc
atgatgactccgtatgtggtgacgagatattacagagcccccgaggtcatcctgggcatg
ggctacaaggagaacgtggacatatggtctgtgggctgcatcatgggagaaatggttcgt
cacaaaatcctctttcccggaagggactatattgaccagtggaacaaagtcatagagcag
ctaggaactccgtgtccagaattcatgaagaaattgcagcccaccgtcagaaactacgtg
gagaaccggcccaagtatgcaggcctcaccttccccaagctctttccagattccctcttc
ccagcggattccgagcacaataaacttaaagccagccaagccagggacttgttgtcaaag
atgttagtgattgacccagcgaagaggatatcggtggatgacgcattgcagcatccgtac
atcaacgtttggtacgaccctgctgaagtggaggcgcctccgcctcagatatatgacaag
caactggatgaaagggagcacaccatcgaagaatggaaagaactcatctacaaggaagta
atgaactcagaagagaagactaagaacggcgtagtcaaaggccagccctcaccttcaggt
gcagcagtgaacagcagtgagagtctccctccatcctcgtctgtcaacgacatctcctcc
atgtccaccgaccagaccctcgcatccgacactgacagcagcctggaagcctcggcggga
ccgctgggttgttgcaggtga

KEGG   Rattus norvegicus (rat): 50658
Entry
50658             CDS       T01003                                 

Gene name
Mapk9
Definition
(RefSeq) mitogen-activated protein kinase 9 isoform 2
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04024  cAMP signaling pathway
rno04068  FoxO signaling pathway
rno04071  Sphingolipid signaling pathway
rno04137  Mitophagy - animal
rno04140  Autophagy - animal
rno04141  Protein processing in endoplasmic reticulum
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04217  Necroptosis
rno04310  Wnt signaling pathway
rno04380  Osteoclast differentiation
rno04510  Focal adhesion
rno04530  Tight junction
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04668  TNF signaling pathway
rno04722  Neurotrophin signaling pathway
rno04723  Retrograde endocannabinoid signaling
rno04728  Dopaminergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04910  Insulin signaling pathway
rno04912  GnRH signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04917  Prolactin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04926  Relaxin signaling pathway
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04935  Growth hormone synthesis, secretion and action
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05133  Pertussis
rno05135  Yersinia infection
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05162  Measles
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05231  Choline metabolism in cancer
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    50658 (Mapk9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    50658 (Mapk9)
   04012 ErbB signaling pathway
    50658 (Mapk9)
   04014 Ras signaling pathway
    50658 (Mapk9)
   04310 Wnt signaling pathway
    50658 (Mapk9)
   04668 TNF signaling pathway
    50658 (Mapk9)
   04068 FoxO signaling pathway
    50658 (Mapk9)
   04071 Sphingolipid signaling pathway
    50658 (Mapk9)
   04024 cAMP signaling pathway
    50658 (Mapk9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    50658 (Mapk9)
   04137 Mitophagy - animal
    50658 (Mapk9)
  09143 Cell growth and death
   04210 Apoptosis
    50658 (Mapk9)
   04215 Apoptosis - multiple species
    50658 (Mapk9)
   04217 Necroptosis
    50658 (Mapk9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    50658 (Mapk9)
   04530 Tight junction
    50658 (Mapk9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    50658 (Mapk9)
   04621 NOD-like receptor signaling pathway
    50658 (Mapk9)
   04622 RIG-I-like receptor signaling pathway
    50658 (Mapk9)
   04625 C-type lectin receptor signaling pathway
    50658 (Mapk9)
   04660 T cell receptor signaling pathway
    50658 (Mapk9)
   04658 Th1 and Th2 cell differentiation
    50658 (Mapk9)
   04659 Th17 cell differentiation
    50658 (Mapk9)
   04657 IL-17 signaling pathway
    50658 (Mapk9)
   04664 Fc epsilon RI signaling pathway
    50658 (Mapk9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    50658 (Mapk9)
   04920 Adipocytokine signaling pathway
    50658 (Mapk9)
   04912 GnRH signaling pathway
    50658 (Mapk9)
   04914 Progesterone-mediated oocyte maturation
    50658 (Mapk9)
   04917 Prolactin signaling pathway
    50658 (Mapk9)
   04926 Relaxin signaling pathway
    50658 (Mapk9)
   04935 Growth hormone synthesis, secretion and action
    50658 (Mapk9)
  09156 Nervous system
   04728 Dopaminergic synapse
    50658 (Mapk9)
   04723 Retrograde endocannabinoid signaling
    50658 (Mapk9)
   04722 Neurotrophin signaling pathway
    50658 (Mapk9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    50658 (Mapk9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    50658 (Mapk9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    50658 (Mapk9)
   05231 Choline metabolism in cancer
    50658 (Mapk9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    50658 (Mapk9)
   05212 Pancreatic cancer
    50658 (Mapk9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    50658 (Mapk9)
   05170 Human immunodeficiency virus 1 infection
    50658 (Mapk9)
   05161 Hepatitis B
    50658 (Mapk9)
   05171 Coronavirus disease - COVID-19
    50658 (Mapk9)
   05162 Measles
    50658 (Mapk9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    50658 (Mapk9)
   05169 Epstein-Barr virus infection
    50658 (Mapk9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    50658 (Mapk9)
   05135 Yersinia infection
    50658 (Mapk9)
   05133 Pertussis
    50658 (Mapk9)
   05152 Tuberculosis
    50658 (Mapk9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    50658 (Mapk9)
   05142 Chagas disease
    50658 (Mapk9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    50658 (Mapk9)
   05012 Parkinson disease
    50658 (Mapk9)
   05016 Huntington disease
    50658 (Mapk9)
   05017 Spinocerebellar ataxia
    50658 (Mapk9)
   05020 Prion disease
    50658 (Mapk9)
   05022 Pathways of neurodegeneration - multiple diseases
    50658 (Mapk9)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    50658 (Mapk9)
   05418 Fluid shear stress and atherosclerosis
    50658 (Mapk9)
   05415 Diabetic cardiomyopathy
    50658 (Mapk9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    50658 (Mapk9)
   04932 Non-alcoholic fatty liver disease
    50658 (Mapk9)
   04931 Insulin resistance
    50658 (Mapk9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    50658 (Mapk9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    50658 (Mapk9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    50658 (Mapk9)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     50658 (Mapk9)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   50658 (Mapk9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kdo RIO1 APH Kinase-like FTA2
Other DBs
NCBI-GeneID: 50658
NCBI-ProteinID: NP_001257473
RGD: 628847
Ensembl: ENSRNOG00000002823
UniProt: P49186 Q6P727 D4A5V8
LinkDB
Position
10
AA seq 423 aa
MSDSKSDGQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMAEMVLHKVLFPGRDYIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVKDQPSDAAVSSKATPSQSSSINDISSMSTEHTLASDTDSSLDASTGPLE
GCR
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgagtgacagtaaaagcgatggccagttttacagtgtgcaagtggcagactcaactttc
actgttctaaaacgttaccagcagttgaaaccaattggctctggagcccaaggaattgtt
tgtgctgcttttgatacagttcttggaataaatgttgctgtcaagaagttaagtcgtcct
tttcagaaccaaacgcatgcaaagagagcctaccgtgaacttgtcctcctaaagtgtgtc
aatcataaaaatataattagcttgttaaatgtgttcacaccacaaaaaacgctagaagaa
ttccaagatgtgtacttggttatggagttaatggacgctaacttatgtcaggttattcat
atggagctggaccatgaaagaatgtcatacctcctctaccagatgctttgtggcattaag
cacctgcattcagctggcataattcatagggatttgaagcctagcaacattgtagtaaaa
tcagactgtactctcaagatccttgactttggcctggcacggacagcctgtaccaacttt
atgatgactccctatgtggtaactcgctactatcgggctccagaagtcatcctgggcatg
ggctacaaggagaatgtggacatctggtctgtcgggtgcatcatggcagaaatggtcctc
cataaagtcctgttcccaggaagagactatattgatcaatggaataaagttattgaacag
ctaggaacaccatccgcagagttcatgaagaaacttcagccaactgtaaggaattatgtg
gaaaacagaccaaagtaccctggaatcaaatttgaagagctctttccagattggatattt
ccgtcagaatccgaacgagacaaaataaaaacaagtcaagccagagatctgttatcgaaa
atgttagtgattgatccggacaagcggatctctgtggacgaagccttgcgccacccgtat
attactgtttggtatgaccccgctgaagcagaagcgccaccacctcaaatttatgatgcc
cagttggaagaaagagagcatgcgattgaagagtggaaagaactaatttacaaagaagtg
atggactgggaagaaagaagcaagaatggggtgaaagaccagccttcagatgcagcagta
agcagcaaggctactccttctcagtcgtcatccatcaatgacatctcatccatgtccact
gagcacaccctggcctcagacacagacagcagtctcgatgcctcaaccggacccctggaa
ggctgccgatga

DBGET integrated database retrieval system