KEGG   Rattus norvegicus (rat): 116719
Entry
116719            CDS       T01003                                 

Gene name
Acacb
Definition
(RefSeq) acetyl-CoA carboxylase 2 precursor
  KO
K01946  acetyl-CoA carboxylase / biotin carboxylase 2 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00061  Fatty acid biosynthesis
rno00620  Pyruvate metabolism
rno00640  Propanoate metabolism
rno01100  Metabolic pathways
rno04152  AMPK signaling pathway
rno04910  Insulin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    116719 (Acacb)
   00640 Propanoate metabolism
    116719 (Acacb)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    116719 (Acacb)
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    116719 (Acacb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    116719 (Acacb)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    116719 (Acacb)
   04922 Glucagon signaling pathway
    116719 (Acacb)
   04920 Adipocytokine signaling pathway
    116719 (Acacb)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    116719 (Acacb)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     116719 (Acacb)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     116719 (Acacb)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     116719 (Acacb)
SSDB
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATP-grasp Dala_Dala_lig_C GxGYxYP_N
Other DBs
NCBI-GeneID: 116719
NCBI-ProteinID: NP_446374
RGD: 620500
Ensembl: ENSRNOG00000000658
UniProt: O70151
LinkDB
Position
12
AA seq 2455 aa
MVLLLFLTCLVFSCLTISWLKIWGKMTDSKPLSNSKVDASLLSSKEESFSASDQSEEHGD
CSCPLTTPDQEELASHGGPVDASQQRNSVPSSHQKPPRNPLSSNDTCSSPELQTNRVAAP
GSEVPEANGLPFPARPQTQRTGSPTREDKKQAHIKRQLMTSFILGSLDDNSSDEDPSASS
FQTSSRKGSRASLGTLSQEAALNTADPESHTPTMRPSMSGLHLVKRGREHKKLDLHRDFT
VASPAEFVTRFGGNRVIETVLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPED
LKANAEYIKMADQYVPVPGGPNNNNYANVELIIDIAKRIPVQAVWAGWGHASENPKLPEL
LCKHEIAFLGPPSEAMWALGDKISSTIVAQTLQIPTLPWSGSGLTVEWTEDSQHQGKCIS
VPEDVYEQGCVRDVDEGLQAAEKVGFPLMIKASEGGGGKGIRRAESAEDFPMLFRQVQSE
IPGSPIFLMKLAQNARHLEVQVLADQYGNAVSLFGRDCSIQRRHQKIIEEAPATIAAPAV
FEFMEQCAVLLAKTVGYVSAGTVEYLYSQDGSFHFLELNPRLQVEHPCTEMIADVNLPAA
QLQIAMGVPLHRLKDIRLLYGESPWGVTPVSFETPLSPPIARGHVIAARITSENPDEGFK
PSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKE
LSIRGDFRTTVEYLVNLLETESFQNNDIDTGWLDHLIAQRVQAEKPDIMLGVVCGALNVA
DAMFRTCMTEFLHSLERGQVLPADSLLNIVDVELIYGGIKYVLKVARQSLTMFVLIMNGC
HIEIDAHRLNDGGLLLSYNGSSYTTYMKEEVDSYRITIGNKTCVFEKENDPTVLRSPSAG
KLMQYTVEDGQHVEVGSSYAEMEVMKMIMTLNVQESGRVKYIKRPGAVLEAGCVVAKLEL
DDPSKVHAAQPFTGELPAQQTLPILGERLHQVFHSVLENLTNVMNGYCLPEPFFSMKLKD
WVEKLMMTLRHPSLPLLELQEIMTSVAGRIPVPVEKAVRRVMAQYASNITSVLCQFPSQQ
IATILDCHAATLQRKVDREAFFMNTQSIVQLIQRYRSGTRGYMKAVVLDLLRRYLNVEHH
FQQAHYDKCVINLREQFKPDMTRVLDCIFSHSQVAKKNQLVTMLIDELCGPDPTLSEELT
SILKELTQLSRSEHCKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCPENL
KKLILSETTIFDVLPTFFYHANKVVCMASLEVYVRRGYIAYELNSLQHRELPDGTCVVEF
QFMLPSSHPNRMAMPINVSDPDLLRHSKELFMDSGFSPLCQRMGAMVAFRRFEEFTRNFD
EVISCFANVPTDTPLFSKACTSLYSEEDSKSLQEEPIHILNVAIQCADHMEDERLVPVFR
AFVQSKKHILVDYGLRRITFLIAQEREFPKFFTFRARDEFAEDRIYRHLEPALAFQLELS
RMRNFDLTAVPCANHKMHLYLGAAKVKEGLEVTDHRFFIRAIIRHSDLITKEASFEYLQN
EGERLLLEAMDELEVAFNNTSVRTDCNHIFLNFVPTVIMDPLKIEESVRAMVMRYGSRLW
KLRVLQAEVKINIRQTTSDCAVPIRLFITNESGYYLDISLYKEVTDSRSGNIMFHSFGNK
QGSLHGMLINTPYVTKDLLQAKRFQAQSLGTTYVYDFPEMFRQALFKLWGSPEKYPKDIL
TYTELVLDSQGQLVEMNRLPGCNEVGMVVFKMRFKTPEYPEGRDTIVIGNDITFQIGSFG
IGEDFLYLRASEMARTEGIPQIYLAANSGARMGLSEEIKQIFQVAWVDPEDPYKGFRYLY
LTPQDYTQISSQNSVHCKHIEDEGESRYVIVDVIGKDSSLGVENLRGSGMIAGEASLAYE
KNVTISMVTCRAIGIGAYLVRLGQRVIQVENSHIILTGAGALNKVLGREVYTSNNQLGGV
QIMHTNGVSHVTVPDDFEGVCTILEWLSYIPKDNQSPVPIITPSDPIDREIEFTPTKAPY
DPRWLLAGRPHPTLKGTWQSGFFDHGSFKEIMAPWAQTVVTGRARLGGIPVGVIAVETRS
VEVAVPADPANLDSEAKIIQQAGQVWFPDSAFKTAQVIRDFNQEHLPLMIFANWRGFSGG
MKDMYEQMLKFGAYIVDSLRLFKQPVLIYIPPGAELRGGAWVVLDSSINPLCIEMYADKE
SRGGVLEPEGTVEIKFRKKDLVKTIRRIDPVCKKLLGQLGTAQLPDKDRKELESQLKARE
DLLLPIYHQVAVQFADLHDTPGHMLEKGIISDVLEWKTTRTYFYWRLRRLLLEAQVKQEI
LRASPELSHEHTQSMLRRWFVETEGAVKAYLWDSNQVVVQWLEQHWSARDNLRSTIRENI
NYLKRDSVLKTIQSLVQEHPEATMDCVAYLSQHLTPAEQMQVVQLLSTTESPASH
NT seq 7368 nt   +upstreamnt  +downstreamnt
atggtcttgcttctctttctgacttgcctggttttctcctgcctgaccatttcctggtta
aaaatctgggggaagatgacagactcgaagccgctcagcaacagtaaggtggatgcaagc
ctcctttcgagcaaggaggagtccttttcagcctcggaccagtcagaggagcatggcgac
tgcagctgtccgttgacaactcctgaccaggaggagctggcctcccacggaggtcctgta
gatgccagtcagcagaggaactctgtgccaagctcacaccagaagcctccgaggaaccca
ctatcttccaatgacacctgttcctccccagaactccaaaccaacagggtagcagcccct
ggctcagaggttccagaagccaacgggttgcctttcccagccaggcctcagacccagaga
acgggatcccccactagggaggacaagaagcaggcacacatcaagaggcagctgatgacc
agctttatcctgggctccctcgatgacaactcctctgacgaggaccctagtgctagctcc
ttccagacctcctctcggaagggcagcagggctagcctgggcaccctgtcccaggaggct
gcattgaacacagctgatcctgagtctcacacacctactatgaggcccagcatgtctgga
ctccatctggtgaagagaggccgtgaacacaagaaactggacctgcacagagatttcact
gtagcttccccagccgaatttgtcacccgctttggaggcaacagggtcatcgagacggtg
ctcatcgccaataatggtatcgctgcggtcaagtgtatgcgctccatccgccgctgggcc
tatgagatgttccgtaatgaacgcgccatccggtttgtggttatggtgacacccgaggat
cttaaggccaacgcagagtacatcaagatggcggaccagtacgttccggtcccaggagga
cccaataataacaactacgccaacgttgagctgatcatagacattgccaagagaatccct
gtgcaggccgtgtgggctggctggggccacgcttcggaaaaccccaaacttccagagcta
ctgtgcaagcacgagattgctttcctaggtcccccgagtgaggccatgtgggccctggga
gacaagatctcctccaccattgtagcccagacattgcagatcccaactctaccctggagc
ggaagcggtctcacagtggagtggacggaggacagccagcatcagggcaaatgcatcagc
gtcccggaagacgtttatgaacaaggctgtgtgagagatgtggacgaaggcttgcaggca
gcagaaaaagtaggatttcctctgatgatcaaagcctctgaaggtggaggagggaaagga
atccgcagggctgagagtgcagaggacttcccgatgcttttcagacaggtgcagagtgag
atcccgggctcgcccatctttctcatgaagctggcccagaatgctcggcacttggaggtc
caggtcttggcagatcagtatgggaacgcagtgtccctgtttggacgagactgctccatc
cagaggcggcaccagaagatcattgaggaggctccggccaccatcgctgctccggctgtg
tttgagttcatggaacagtgtgccgtcctcctggccaagactgtgggttatgtgagcgcg
ggaaccgtggagtacctatacagccaggatggcagctttcacttcttggagctgaaccca
cgcctgcaggtggaacatccctgcactgaaatgatcgcagatgtcaacctgcccgctgca
cagttacagatcgccatgggcgtgcccctgcaccggctgaaggacatacggcttctgtac
ggagagtccccctggggagtgacccccgtttcttttgagacccctttgagccctcccatt
gcccgaggccatgtcattgcagccaggatcaccagcgaaaacccagacgagggctttaag
ccaagctcagggacagtgcaggagctgaacttccgcagcaacaagaacgtgtggggttac
ttcagcgtggccgctgctgggggcttgcacgagtttgccgattcccagtttgggcactgc
ttctcctggggcgagaaccgtgaagaggctatttcgaacatggtggtggctttgaaagaa
ctgtctatccggggtgacttccggaccaccgtggaatatctcgtcaaccttctggagacg
gagagcttccagaacaatgatatcgacacagggtggctggaccacctcatcgctcagcgg
gtgcaggcagagaagccggacatcatgctcggggtggtgtgtggggccttgaacgtggca
gacgcgatgttcagaacctgtatgacggaattcctgcattccttggaaaggggtcaggtc
ctcccggctgattctctgctgaacatcgtggacgttgagttgatttacggaggcatcaaa
tatgttctcaaggtggcccggcagtccctgaccatgtttgtcctcatcatgaatggttgc
cacatcgagatcgatgcccaccggctgaacgatgggggcctgctcctgtcctacaatggt
agcagttacactacatacatgaaggaagaggtggacagttaccggatcactatcggcaat
aagacatgcgtgtttgaaaaggaaaacgaccccaccgtcctgagatccccctcggctggg
aagctgatgcagtacacggtggaggatggccagcacgtggaagtcgggagcagctatgct
gagatggaggtgatgaagatgatcatgaccctgaacgtgcaagagagcggccgggtgaag
tacatcaagcgaccaggggcggtattggaggctggctgcgtggtggcaaagctagaactc
gatgacccttcaaaagtgcacgcggcacagccgttcacaggggagctccccgcccagcag
actctgcccatcctcggggagaggctgcatcaggtgttccacagcgtcttggaaaatctg
accaatgtcatgaatggctactgcctgcccgagcccttcttcagcatgaagctgaaggac
tgggtggagaagctcatgatgactctccggcatccctccctacctctgctggagctgcag
gagatcatgaccagcgtggcaggccgcatcccggttccggtggagaaggcagtccgcagg
gtgatggcgcagtacgccagcaacatcacttcggtgctctgccagttccccagccagcag
atagccaccatcctggactgccacgccgccaccctgcagcgtaaggtggaccgagaggcc
ttcttcatgaacacacagagcatcgtgcagctgatccagagataccgcagtgggacccgt
ggctacatgaaggctgtggtgctagacctcctgaggagatatctgaacgtggagcatcat
ttccagcaagcccactatgacaagtgtgtgatcaacctgagggagcagttcaagccggac
atgactcgggtgctggactgcatcttctcacactcacaagtggccaagaagaaccagctg
gtgaccatgttgatagatgagctgtgtggcccagaccccaccctgtcagaagagctgacc
tccatcctcaaggaactcacgcagttgagcaggagtgagcactgcaaggtggccctcaga
gccaggcaggtcctgattgcctctcacctcccctcctacgagctgcggcacaaccaggtg
gagtccatcttcctgtcagccattgacatgtatggccaccagttctgcccggaaaacctc
aagaaactaatactttcggaaacgaccatattcgatgtcctgcccactttcttctatcac
gctaacaaggtcgtctgtatggcgtccctggaggtttatgtgaggagaggttacatcgcc
tacgagttaaacagcctacagcaccgggagctccctgacggcacctgcgtggtggagttc
cagttcatgctgccgtcttcccaccccaaccggatggccatgcccatcaatgtctctgac
cctgacctgctgagacacagtaaggaactcttcatggacagtggcttctccccactgtgc
cagcggatgggggccatggtggccttcaggagatttgaggagttcaccaggaacttcgat
gaagtcatctcctgctttgccaacgtgcctacagacactcctctcttcagtaaggcgtgc
acttccctctactcagaggaggacagcaagagccttcaagaggagcccatccacatcctg
aatgtggccatccagtgcgccgaccacatggaggacgagagactggtgccggttttccgt
gcctttgtacagtccaagaaacacatccttgtggattacggactgcgaagaatcacattc
cttatcgcccaagagagagaatttcccaagttcttcacgttcagagcgagagatgagttt
gcagaagaccggatttaccgccacttggagccggccctggccttccagctggagctgagc
cggatgcgcaactttgacctgacggccgtgccctgtgccaaccataagatgcatctttac
ctgggagccgccaaggtgaaggaagggctggaggtgactgaccacaggttcttcatccga
gccatcataaggcactcagacctgatcaccaaggaagcctccttcgagtacctgcagaat
gaaggggagcggctgctgctggaagccatggacgagctggaggtggcgttcaacaacacc
agcgtgcgcactgactgcaaccacatcttcctcaacttcgtgcccacggtcatcatggac
ccactcaagatcgaggagtcggtgcgtgccatggtcatgcgttacggcagtcggctgtgg
aagctccgtgtgctgcaggcagaagttaagatcaacatccgtcagacgacctcggactgc
gccgtccccattcgcctcttcatcaccaacgagtccggctactacctggacatcagcctc
tacaaagaagtgaccgactccagatccggaaacatcatgtttcattccttcggcaacaaa
caagggagcctgcacgggatgctgatcaacacgccctacgtcaccaaggatctgctccaa
gccaagcgattccaggcgcagtccctggggaccacctatgtgtacgacttcccagagatg
ttcaggcaggctctctttaaattgtggggctccccagagaagtaccccaaagatatcctg
acatacacagagctggtgttggactcccagggccagctggtggagatgaaccggcttcct
ggttgtaacgaggtgggcatggtggttttcaaaatgaggttcaagaccccggagtatcca
gaaggccgggacactatcgtcatcggcaacgacattaccttccaaatcggctctttcggc
ataggagaggacttcctgtatctacgggcatcggagatggcccggacagagggcatcccc
caaatctatctggcagccaacagcggggcccgtatgggcctgtccgaggagatcaagcag
atattccaagtggcatgggtggaccctgaggatccctacaaaggatttagatacctgtac
ctgacgccccaagactacacccagatcagctcccagaactccgtgcactgcaaacacatc
gaggacgaaggcgagtccaggtatgtcatcgttgatgtcatcgggaaggacagcagcctg
ggtgtggagaacctgcggggctcgggcatgattgcaggagaggcttctctggcttacgaa
aaaaatgtcaccatcagcatggtgacctgccgcgccatcggaatcggggcttacctggtg
aggctgggccagcgggtgatccaggtggaaaactcccacatcatcctcacgggagccggt
gctctcaacaaggtcctgggaagagaggtctacacatccaacaaccaactgggcggtgtg
cagatcatgcacaccaacggggtctcccacgtcacggtgccagatgacttcgagggggtc
tgcaccattctggaatggctgtcatatataccaaaggacaatcaaagcccagtccccatc
atcactccttctgaccccatcgacagggaaattgaattcaccccaaccaaagctccctat
gaccccaggtggctgctggcagggaggcctcacccaactctgaaggggacctggcagagt
ggattcttcgaccatggcagtttcaaggaaatcatggcaccctgggcccagactgtggtg
actggacgagcaaggctggggggcatccctgtaggggtgattgccgtggagactcggtct
gtggaggtggctgtccctgctgaccctgccaacttggattctgaggccaagatcatccag
caggcaggccaggtgtggttcccggactctgccttcaagacggctcaggtcatcagggac
ttcaaccaggagcatctgcctctcatgatctttgctaactggagaggcttctcgggcggc
atgaaagacatgtacgagcagatgctgaagtttggcgcctacatcgtggacagtctccgt
ctgttcaagcagccagttctcatctatatccctcccggtgccgaactccgagggggcgcc
tgggttgtcctcgactccagcatcaaccccctgtgcatagagatgtacgcagacaaagag
agcagggggggtgtcctggagcccgagggcactgtggagattaagttccggaagaaagat
ttggtgaagaccataaggaggattgacccagtgtgcaagaaactcctggggcagctgggg
acagcccagctccctgacaaggaccggaaagagctggagagccagctgaaggcccgggag
gacctgctgctccccatctaccaccaggtggcagtgcagttcgccgacctgcatgacacg
ccgggccacatgctggagaagggaatcatttctgatgtgctggagtggaagaccacacgt
acctacttctactggaggctgcgccggctgctgctggaggcacaggtgaagcaggagatt
ctgcgagccagccctgagctgagccatgagcacacgcagtccatgctgcgacgctggttt
gtggagaccgagggcgccgtcaaggcctacctgtgggacagcaaccaggtggtagtccag
tggctggaacagcactggtcagccagggacaacctgcgttccactatccgagagaacatc
aattatctgaagcgggactctgtcctcaagaccatccaaagcctagttcaagaacaccca
gaggcgaccatggactgtgtggcatacctgagccagcacctcacgcccgctgagcagatg
caggtggttcagctgctgtctaccacggagagcccagcttcccactga

KEGG   Rattus norvegicus (rat): 60581
Entry
60581             CDS       T01003                                 

Gene name
Acaca
Definition
(RefSeq) acetyl-CoA carboxylase 1
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00061  Fatty acid biosynthesis
rno00620  Pyruvate metabolism
rno00640  Propanoate metabolism
rno01100  Metabolic pathways
rno01212  Fatty acid metabolism
rno04152  AMPK signaling pathway
rno04910  Insulin signaling pathway
rno04922  Glucagon signaling pathway
Module
rno_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    60581 (Acaca)
   00640 Propanoate metabolism
    60581 (Acaca)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    60581 (Acaca)
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    60581 (Acaca)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    60581 (Acaca)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    60581 (Acaca)
   04922 Glucagon signaling pathway
    60581 (Acaca)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     60581 (Acaca)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     60581 (Acaca)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     60581 (Acaca)
SSDB
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl Dala_Dala_lig_C ATP-grasp ATP-grasp_3 MetallophosN
Other DBs
NCBI-GeneID: 60581
NCBI-ProteinID: NP_071529
RGD: 621248
Ensembl: ENSRNOG00000034013
UniProt: P11497
LinkDB
Position
10
AA seq 2345 aa
MDEPSPLAKTLELNQHSRFIIGSVSEDNSEDEISNLVKLDLEEKEGSLSPASVSSDTLSD
LGISALQDGLAFHMRSSMSGLHLVKQGRDRKKIDSQRDFTVASPAEFVTRFGGNKVIEKV
LIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGG
ANNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALG
DKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRILNVPQDLYEKGYVKDVDDGLKAA
EEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQ
ILADQYGNAISLFGRDCSVQRRHQKIIEEAPAAIATPAVFEHMEQCAVKLAKMVGYVSAG
TVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLFRIKDIRMMYG
VSPWGDAPIDFENSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYF
SVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETE
SFQLNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVNLRNSISNFLHSLERGQVL
PAHTLLNTVDVELIYEGIKYVLKVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDGS
SYTTYMKEEVDRYRITIGNKTCVFEKENDPSVMRSPSAGKLIQYIVEDGGHVFAGQCYAE
IEVMKMVMTLTAVESGCIHYVKRPGAALDPGCVIAKMQLDNPSKVQQAELHTGSLPQIQS
TALRGEKLHRVFHYVLDNLVNVMNGYCLPDPFFSSKVKDWVERLMKTLRDPSLPLLELQD
IMTSVSGRIPLNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVF
FMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSDM
NTVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALRA
RQVLIASHLPSYDVRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHS
NQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMS
FASNLNHYGMTHVASVSDVLLDNAFTPPCQRMGGMVSFRTFEDFVRIFDEVMGCFCDSPP
QSPTFPESGHTSLYDEDKVPRDEPIHILNVAIKTDGDIEDDRLAAMFREFTQQNKATLVE
HGIRRLTFLVAQKDFRKQVNCEVDQRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQL
ELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEY
LQNEGERLLLEAMDELEVAFNNTNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYGS
RLWKLRVLQAELKINIRLTTTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAY
GDKQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMSTQAF
LPSPPLPSDILTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMSLKSPEYPDGRDVIVIG
NDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVAANSGARIGLAEEIRHMFHVAWVDS
EDPYKGYKYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGAENLRGSG
MIAGESSLAYDEIITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGRE
VYTSNNQLGGIQIMHNNGVTHCTVCDDFEGVFTVLHWLSYMPKNVHSSVPLLNSKDPIDR
IIEFVPTKAPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGI
PVGVVAVETRTVELSVPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLM
VFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECSQPVMVYIPPQAELRGGSWVVIDPTIN
PRHMEMYADRESRGSVLEPEGTVEIKFRKKDLVKTMRRVDPVYIRLAERLGTPELSPTER
KELESKLKEREEFLIPIYHQVAVQFADLHDTPGRMQEKGVINDILDWKTSRTFFYWRLRR
LLLEDLVKKKIHSANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLVEWLEKQLTEE
DGVRSVIEENIKYISRDYVLKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTM
DSPST
NT seq 7038 nt   +upstreamnt  +downstreamnt
atggatgaaccatctccgttggccaaaaccctggagctgaaccagcactcccgattcata
attgggtccgtgtctgaagacaactcagaagatgagatcagtaacctggtaaagctggac
ctagaggagaaggagggctccctgtcaccagcctctgtcagctcagatacactttctgat
ttgggaatctctgccttacaggatggtttggcctttcacatgaggtccagcatgtccggc
ttgcacctagtaaaacaaggtcgagacagaaagaaaatagactctcaacgagatttcact
gtggcttcgccagcagaatttgttactcgttttgggggaaataaagtgattgagaaggtt
cttatcgccaacaatggtattgcagcagtgaaatgcatgcgatctatccggcggtggtct
tatgaaatgttccgcaatgaacgtgccatccggtttgttgtcatggttacacccgaagac
cttaaagccaatgcagaatacattaagatggcggatcactatgttccagtgcctggagga
gcaaacaacaacaattatgcaaatgtggaattgattcttgatattgcgaaaaggatacct
gtacaggcagtgtgggctggctggggtcatgcctccgagaaccccaagctcccggagcta
ctcttaaaaaatggcattgctttcatgggccctccgagtcaggccatgtgggcgttgggg
gataagattgcatcgtctattgtggctcaaactgcaggtatccccactcttccctggagt
ggcagtggtcttcgagtggattggcaagaaaatgatttttcgaaacgcatcttaaatgtt
ccacaggatctgtatgagaaaggctatgtgaaggatgtggatgatggactgaaggcagcc
gaggaggttggctatccagtgatgatcaaggcctcagagggaggaggagggaagggaatc
agaaaagttaacaatgcagatgacttccctaacctcttcagacaggttcaagctgaagtc
cctggatcacctatatttgtaatgagattagcaaaacagtctcgtcatctggaggtccag
attctggcggatcagtatggcaatgcaatttctttgtttggtcgtgactgctctgtacaa
cgcaggcatcagaagatcattgaagaagctcctgctgctattgctaccccagcagtattt
gaacacatggaacagtgtgctgtaaaacttgccaaaatggttggttatgtgagcgctggg
actgtggaatacttgtacagccaggacggaagcttctacttcttggaactgaaccctcgg
ctacaggttgaacatccttgtacagagatggtggctgatgtcaatcttcctgcagcacag
ctccagattgccatggggatccctctatttaggatcaaggatattcgtatgatgtatggg
gtatctccttggggtgatgctcccattgattttgaaaattctgctcatgttccttgccca
aggggccatgtgattgctgctcggatcaccagtgaaaacccagatgaggggtttaagccc
agctctggaacagttcaggaacttaattttcgcagcaataagaatgtttggggttatttc
agtgttgctgctgctgggggacttcatgaatttgctgattctcagttcggtcactgcttt
tcctggggagaaaacagagaagaagcaatttcaaatatggtggtggcattgaaggagctg
tctattcggggtgactttcgaactacagtagaatacctcatcaagctgctggagacagaa
agctttcagttgaacagaatcgacactggctggctggacagactgattgcagagaaagtg
caggcagagcgtcctgacaccatgttgggagttgtgtgtggggctcttcatgtggcagat
gtgaacctgagaaatagcatctctaacttccttcactccttagagaggggtcaagtcctt
cctgctcacacacttctgaacacagtagatgttgaacttatctatgaaggaatcaaatat
gtacttaaggtgactcggcagtctcccaactcctacgtggtgataatgaacggctcgtgt
gtggaagtggacgtgcaccggctgagtgatggtggactgctcttgtcctacgatggcagc
agttacaccacatacatgaaggaggaggtagacagataccgaatcacaattggcaataaa
acctgtgtgtttgagaaggaaaatgacccgtctgtaatgcgctccccgtctgctgggaag
ttaatccagtatattgtggaagatggaggccatgtgtttgctggccagtgctatgcagag
attgaggtaatgaagatggtaatgactttgacagctgtagaatctggctgcatccattat
gtcaagcgacctggagcagcacttgacccaggctgtgtgatagccaaaatgcagctggac
aatcccagtaaagttcaacaggctgagcttcacacgggcagtctgccccagatccagagc
acagctctccgaggcgaaaagctccatcgagttttccactatgtcctggataacctggtc
aatgtgatgaatggatactgccttccagaccctttcttcagcagcaaggtaaaggactgg
gtagaacggttaatgaagactctgagagacccctccctgcctcttctagaattgcaggat
atcatgaccagtgtctctggccggatccccctcaacgtggagaagtctattaagaaggaa
atggctcagtatgctagcaacatcacatcggtcctgtgtcagtttcccagccagcagatt
gccaacatcctagatagtcatgcagctacactgaaccggaaatcggagcgggaagtcttc
ttcatgaacacccagagcattgtccagctggtgcagaggtaccgaagtggcatccgtggc
cacatgaaggctgtggtgatggatctgctccggcagtacctgcgggtggagacacagttt
cagaatggccactacgacaaatgtgtattcgcccttcgggaagagaacaaaagtgacatg
aacaccgtactgaactacatcttctcccacgcccaggtcaccaagaagaatctcctggtg
acaatgcttattgatcagttgtgtggccgggaccctacacttactgatgagctgctaaac
atcctcacagagctaactcagctcagcaaaaccaccaacgccaaagtggcactgcgggct
cgccaggttcttattgcctcccatttgccatcgtacgacgttcgccataaccaagtagag
tccatcttcttatcagccatcgacatgtatggacaccagttttgcattgagaacctgcag
aaactcatcctatcagaaacatctattttcgatgtcctcccaaactttttttaccacagc
aaccaggtggtgaggatggcggctctggaggtatatgttcgaagagcttatatcgcctat
gagctcaacagtgtacagcatcgccagcttaaggacaacacctgtgtggtagaatttcag
ttcatgctgcccacatctcatccaaacagagggaacatccccacgctaaacagaatgtcc
tttgcctccaacctcaaccactacggcatgactcatgtagctagtgtcagcgatgttctg
ttggacaacgccttcacaccaccttgtcaacgcatgggcgggatggtctctttccggacc
tttgaagatttcgtcaggatctttgatgaagtaatgggctgcttctgcgactccccaccc
caaagccccacattcccagagtccggtcacacttcactctatgatgaggacaaggtcccc
agggacgaaccaatacatattctgaatgtggctatcaagactgatggcgatattgaggat
gacaggcttgcagctatgttcagagagttcacccaacagaataaagctactctggttgag
catgggatccggcgacttacgttcctagttgcacaaaaggatttcagaaaacaagtcaac
tgtgaggtggatcagagatttcatagagaattccccaaatttttcacattccgagcaagg
gataagtttgaggaggaccgcatttatcgacatctggagcctgctctggctttccagtta
gagctgaaccggatgagaaattttgaccttactgccattccatgcgctaatcacaagatg
cacctgtaccttggggctgctaaggtggaagtaggcacagaagtgactgactacaggttc
tttgttcgtgcgatcatcaggcactctgatctggtcacgaaggaagcttcttttgaatat
ctacaaaatgaaggagagcgactgctcctggaagccatggatgaattggaagttgctttc
aataacacaaatgttcgcacagactgtaaccatatattcctcaactttgtgcccacagtc
atcatggacccatcaaagattgaagaatctgtgcggagcatggtaatgcgctatggaagc
cggctgtggaaattgcgggtcctccaggcagaactgaaaatcaacattcgcctgacaaca
actggaaaagcgattcccatccgcctcttcctgacaaacgagtctggctactacttggac
atcagcctgtataaggaagtgactgactccaggacagcacagatcatgtttcaggcgtat
ggagacaagcagggaccactgcatggaatgttaatcaatactccgtatgtgaccaaagac
cttcttcaatcaaagaggtttcaggcacagtccttgggaacaacgtatatatatgatatc
ccagagatgtttcggcagtcgctcatcaagctctgggagtccatgtccactcaagcattt
cttccttcaccccctttgccttccgacatactgacgtatactgaactggtgttggatgat
caaggccagcttgtccatatgaacagacttccaggaggaaacgagattggcatggtagcc
tggaaaatgagccttaaaagccctgaatatccagatggccgagatgtcattgtcatcggc
aatgacattacatatcggattggctcctttgggcctcaggaagatttgctgtttctcaga
gcttctgaacttgccagagcagaaggcatcccacgcatctacgtagcagccaacagtgga
gctagaattggactggcagaagaaatccgtcatatgttccacgtggcctgggtagactct
gaggatccttacaagggatacaagtatttatatctgacaccccaggattataaaagagtg
agtgctctcaattctgtccactgtgaacatgtggaagatgaaggagaatccaggtacaag
ataacagacattatcgggaaagaagaaggacttggagcagagaaccttcggggttctgga
atgattgctggggaatcctcattggcttatgatgagatcatcaccatcagcctggttaca
tgccgggccattggtattggggcttaccttgtccggctgggacaaagaaccatccaggtt
gagaactctcacttaattctaacaggagccggtgccctcaacaaagtccttggtcgggaa
gtatacacctccaacaatcagcttgggggcatccagataatgcacaacaacggagttacc
cattgcactgtttgtgatgactttgagggagtgttcacagtcttacactggctgtcatac
atgcctaagaacgtgcacagttcagttcctctcctgaattccaaggatcctatagataga
atcatcgagtttgttcccacaaaggccccgtatgatcctcggtggatgctggcaggccgt
cctcacccaacccagaaaggccaatggttgagtggattttttgattatggctctttctca
gaaatcatgcagccctgggcgcagaccgtggtagttggcagagccaggttggggggaata
cctgtgggagtagttgctgtagaaacccgaaccgtggagctcagtgtaccagctgatcct
gcaaacctggattctgaagccaagataatccagcaggccggccaagtttggtttccagac
tctgcatttaagacctatcaagctatcaaggactttaaccgtgaagggctacctctaatg
gtctttgccaactggagaggcttctctggtgggatgaaagatatgtatgaccaggtgctc
aagtttggtgcttatattgtggatggcttgcgggaatgttcccagcctgtgatggtctac
attcccccacaggctgagcttcggggtggttcttgggttgtgatcgacccaaccatcaat
cctcggcacatggagatgtatgctgaccgggaaagcaggggatccgttctggaaccagaa
gggacagtagaaatcaaattccgcaaaaaggatctggtgaaaaccatgcgtcgcgtagac
ccagtctacatccgcttggctgagcgactgggcaccccagagctaagccccactgagcgg
aaggagctggagagcaagttgaaggagcgggaggagttcctaattcccatttaccatcag
gtagctgtgcagtttgctgacttgcacgacaccccaggccggatgcaggagaagggtgtc
attaatgatatcttagattggaaaacatcccgcaccttcttctactggcgactgaggcgt
ctcctgctggaagacctggtcaagaagaaaatccacagtgccaaccctgagctgaccgat
ggccagatccaggccatgttgagacgctggtttgtggaagtggaaggcacagtgaaggct
tacgtctgggacaataataaggatctggtggaatggctggagaagcagctgacagaggaa
gatggtgtccgctctgtgatagaggagaacatcaaatacatcagcagggactatgtcctc
aagcagatccgcagcttggtgcaggccaatccagaagttgccatggactccatcgtccac
atgacccagcacatctcccccactcagcgagcagaggttgtaaggatcctttccactatg
gactccccttctacgtag

DBGET integrated database retrieval system