KEGG   Rattus norvegicus (rat): 117098
Entry
117098            CDS       T01003                                 

Gene name
Pdha2
Definition
(RefSeq) pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial precursor
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00020  Citrate cycle (TCA cycle)
rno00620  Pyruvate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno04066  HIF-1 signaling pathway
rno04922  Glucagon signaling pathway
rno05230  Central carbon metabolism in cancer
rno05415  Diabetic cardiomyopathy
Module
rno_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    117098 (Pdha2)
   00020 Citrate cycle (TCA cycle)
    117098 (Pdha2)
   00620 Pyruvate metabolism
    117098 (Pdha2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    117098 (Pdha2)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    117098 (Pdha2)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    117098 (Pdha2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    117098 (Pdha2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     117098 (Pdha2)
SSDB
Motif
Pfam: E1_dh TPP_enzyme_C DXP_synthase_N DUF2776
Other DBs
NCBI-GeneID: 117098
NCBI-ProteinID: NP_446446
RGD: 620095
Ensembl: ENSRNOG00000016223
UniProt: Q06437
LinkDB
Position
2
AA seq 391 aa
MRKMLATVLSQVFSGMVQKPALRGLLSSLKFSNDATCDIKKCDLYLLEQGPPTSTVLTRE
EALKYYRNMQVIRRMELKADQLYKQKFIRGFCHLCDGQEACNVGLEAGINPTDHIITSYR
AHGLCYTRGLSVKSILAELTGRKGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGVAL
ACKYLKNGQICLALYGDGAANQGQVFEAYNMSALWKLPCVFICENNRYGMGTAIERSAAS
TDYHKKGFVIPGLRVNGMDILSVREATKFAADHCRSGKGPIVMELQTYRYHGHSMSDPGI
SYRTREEVQNVRSKSDPIMLLRERMISNNLSSVEELKEIDADVKKEVEEAAQFATTDPEP
PLEDLANYLYHQNPPFEVRGAHKWLKFKSVS
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgaggaaaatgctggccactgtgctgtctcaagtattttcaggaatggtccagaagcca
gctctcaggggactgctgtcatctcttaagttctccaacgacgccacctgtgacatcaag
aaatgcgacttgtacctgttggaacagggcccccccacctccactgtgctcaccagagag
gaggccctgaaatactaccggaacatgcaggtaattcggcgcatggagttgaaggccgac
cagctgtataagcagaaattcatccgtggtttctgtcacctgtgtgatgggcaggaagcc
tgcaatgtggggctggaggcagggataaatcccacagaccacatcatcacgtcctacaga
gctcatggcttgtgctacacgaggggactgtcagtgaagtccattctcgcagagctgact
ggacgcaaaggaggctgtgctaaaggcaagggaggctctatgcacatgtacgccaagaac
ttctatgggggcaatggcattgttggggcacaggtacccctgggagctggtgtggctctc
gcctgtaaatacctgaagaatggtcagatctgcttggctttgtatggcgatggtgcggct
aaccaagggcaggtatttgaagcttacaatatgtcagccttgtggaaattaccctgtgtt
ttcatctgtgagaataaccgctatggaatgggaacagctattgagagatcagcagccagt
actgattaccacaagaaaggctttgttatccctggactgagggtgaatgggatggatatt
ctcagtgttcgtgaggcgaccaagtttgcagctgatcactgcagatccggaaaggggccc
attgtgatggagttgcagacataccgttatcatggacacagtatgagcgatccagggatc
agttatcgtacacgagaagaagttcagaacgtgaggagtaagagtgatccaataatgctt
ctccgagagagaatgataagcaacaacctcagcagtgttgaagaattgaaagaaattgat
gcagatgtgaagaaagaagtcgaggaagcagctcagtttgctacaactgatccagaacca
cctctggaagatttagccaattacctctaccaccaaaatccaccatttgaagtccgtggt
gcacataaatggctgaagtttaagtctgtcagttag

KEGG   Rattus norvegicus (rat): 289950
Entry
289950            CDS       T01003                                 

Gene name
Pdhb
Definition
(RefSeq) pyruvate dehydrogenase E1 component subunit beta, mitochondrial precursor
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00020  Citrate cycle (TCA cycle)
rno00620  Pyruvate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno04066  HIF-1 signaling pathway
rno04922  Glucagon signaling pathway
rno05230  Central carbon metabolism in cancer
rno05415  Diabetic cardiomyopathy
Module
rno_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    289950 (Pdhb)
   00020 Citrate cycle (TCA cycle)
    289950 (Pdhb)
   00620 Pyruvate metabolism
    289950 (Pdhb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    289950 (Pdhb)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    289950 (Pdhb)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    289950 (Pdhb)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    289950 (Pdhb)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     289950 (Pdhb)
SSDB
Motif
Pfam: Transket_pyr Transketolase_C
Other DBs
NCBI-GeneID: 289950
NCBI-ProteinID: NP_001007621
RGD: 1359146
Ensembl: ENSRNOG00000007895
UniProt: P49432
LinkDB
Position
15
AA seq 359 aa
MAAVAGLVRGPLRQASGLLKRRFHRSAPAAVQLTVREAINQGMDEELERDEKVFLLGEEV
AQYDGAYKVSRGLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAI
DQVINSAAKTYYMSAGLQPVPIVFRGPNGASAGVAAQHSQCFAAWYGHCPGLKVVSPWNS
EDAKGLIKSAIRDDNPVVMLENELMYGVAFELPTEAQSKDFLIPIGKAKIERQGTHITVV
AHSRPVGHCLEAAAVLSKEGIECEVINLRTIRPMDIEAIEASVMKTNHLVTVEGGWPQFG
VGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAKILEDNSIPQVKDIIFAIKKTLNI
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggcggcggtggctggtctggtgcggggacctttgcggcaggcttccgggctgctgaag
aggcgtttccaccgctcggcgcccgcggcggtgcagttgacagttcgtgaagccattaat
caaggtatggatgaagaactagaaagagatgaaaaggtttttctgcttggggaagaagtt
gcccagtatgatggtgcatacaaggttagcagaggcctgtggaagaaatatggtgacaag
aggatcatagatactcccatatcggagatgggctttgctggaattgctgttggtgcagct
atggctgggctgcggcccatctgtgaatttatgaccttcaatttctctatgcaagctatt
gaccaggtcataaactcagctgccaagacgtactatatgtctgctggcctccagccggtg
cccatagtgttcagggggcccaacggcgcctcagcgggcgtggctgctcagcactcgcaa
tgcttcgctgcgtggtatgggcactgccccggtttgaaagtggtcagcccctggaattcc
gaggatgcgaaaggacttattaaatcggccattcgtgatgataatccagtggtgatgcta
gagaatgaactgatgtatggagttgcatttgaacttcccacagaagctcaatcaaaagat
ttcctgattcctattggaaaagccaaaattgaaaggcaagggacccacatcactgtagtt
gcccattcaagaccagtgggccactgcctagaagctgcagctgtattgtctaaggaggga
attgaatgtgaggtaataaatctgcggaccatcagaccaatggacattgaagctatagaa
gccagtgtcatgaagacaaatcatctcgtaactgtggaaggaggctggccacaatttgga
gtaggagctgagatttgtgcgagaattatggaaggccctgcattcaacttccttgatgcg
cctgctgttcgagtcactggtgctgatgtccctatgccttacgcaaagattctagaagac
aactccatacctcaggtcaaagacatcatatttgcaataaagaagactttgaatatctaa

KEGG   Rattus norvegicus (rat): 29554
Entry
29554             CDS       T01003                                 

Gene name
Pdha1
Definition
(RefSeq) pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial precursor
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00020  Citrate cycle (TCA cycle)
rno00620  Pyruvate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno04066  HIF-1 signaling pathway
rno04922  Glucagon signaling pathway
rno05230  Central carbon metabolism in cancer
rno05415  Diabetic cardiomyopathy
Module
rno_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    29554 (Pdha1)
   00020 Citrate cycle (TCA cycle)
    29554 (Pdha1)
   00620 Pyruvate metabolism
    29554 (Pdha1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    29554 (Pdha1)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    29554 (Pdha1)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    29554 (Pdha1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    29554 (Pdha1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     29554 (Pdha1)
SSDB
Motif
Pfam: E1_dh DXP_synthase_N TPP_enzyme_C
Other DBs
NCBI-GeneID: 29554
NCBI-ProteinID: NP_001004072
RGD: 3286
Ensembl: ENSRNOG00000025383
UniProt: Q4FZZ4
LinkDB
Position
X
AA seq 390 aa
MRKMLAAVSRVLAGAAQKPASRVLVASRNFANDATFEIKKCDLHRLEEGPPVTTVLTRED
GLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEAGINPTDHLITAYRA
HGFTFTRGLPVRAILAELTGRRGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALA
CKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAAST
DYYKRGDFIPGLRVDGMDILCVREATKFAAAYCRSGKGPILMELQTYRYHGHSMSDPGVS
YRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFATADPEPP
LEELGYHIYSSDPPFEVRGANQWIKFKSVS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgaggaagatgcttgccgctgtgtcccgcgtgttggcaggcgctgcgcagaagccggca
agcagagtgctggtagcttcccgtaatttcgcaaatgatgctacatttgagattaagaaa
tgtgaccttcatcgtctagaagagggccctccagtcaccacagtgctcaccagagaggat
gggctcaagtactacaggatgatgcagaccgtgcgccggatggagctcaaggcggatcag
ctgtataagcagaaaattattcgtggtttctgtcacttgtgtgatggtcaggaagcctgc
tgtgtgggcctggaggctggcataaaccccacggaccatctcatcactgcctatcgagcc
catggcttcaccttcactcggggcctgcctgtccgagcaattcttgcagaattaacagga
cgaagaggaggctgtgctaaggggaaaggcggatcaatgcacatgtacgccaagaacttc
tatggcggcaacggtatcgttggagctcaggtgcccctgggtgcaggaattgctctggcc
tgcaagtataatggcaaagatgaggtctgtttgacattatatggtgatggtgctgctaac
cagggtcagatatttgaagcttacaatatggcagcattgtggaaattaccttgtattttc
atctgtgagaataaccgctatggcatgggcacatctgttgagagagcagcagccagcacg
gattactacaaaagaggagatttcattcctggactgagggtagatggaatggatatcttg
tgtgtccgagaggcaacaaagtttgcagctgcctactgcaggtctggtaaggggcctatc
ctgatggagctacagacttaccgctaccatggacatagtatgagtgaccctggagtcagt
tatcgcactcgagaagaaatccaggaagtaagaagtaagagtgaccctattatgcttctc
aaggatagaatggtgaacagcaatcttgcaagtgttgaagaattaaaggagattgatgtg
gaagtgaggaaagaaatcgaggatgctgcccagtttgccacggctgatccggagccgcca
ttggaggagctaggctatcatatctacagcagtgacccacccttcgaagtgcgtggtgcc
aaccagtggatcaagtttaagtcagtcagttaa

DBGET integrated database retrieval system