KEGG   Rattus norvegicus (rat): 140945
Entry
140945            CDS       T01003                                 
Symbol
Rtn3
Name
(RefSeq) reticulon-3 isoform A
  KO
K20723  reticulon-3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    140945 (Rtn3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    140945 (Rtn3)
   03036 Chromosome and associated proteins [BR:rno03036]
    140945 (Rtn3)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    140945 (Rtn3)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation proteins
   Spindle formation proteins
    140945 (Rtn3)
SSDB
Motif
Pfam: Reticulon
Other DBs
NCBI-GeneID: 140945
NCBI-ProteinID: NP_543185
RGD: 620988
Ensembl: ENSRNOG00000021202
UniProt: Q6RJR6
LinkDB
Position
1:complement(204612675..204669212)
AA seq 940 aa
MAESSAATQSPSVSSSSSGAEPSTLGGGGGSPGACPALGAKSCGSSCAVGLSSLCSDEPP
SKIMTSSFLSSSEIYNPDPTTPLGSETLGSHLVAKDGKDPLVLLDKKTLDSPQGTNKDRV
DTPVSLAADIPCSHPSIPDSFPEQPTFLSKETDPTEEWVVKNQEPKNPSEVPSGEDRSAL
DLGQRKAEHICTHSLSPSEPAVASVEKDSPESPFEVIIDKATFDREFKDLYKESTDDLGG
WAAHGDRESPADLLEMNDKVFPLRNKEAGRYPSSALLGRQFSHTTAALEEVSRCVNDMHN
FTNEILTWDLDPQAKQQADKSPCTTESTGLDRSEHRSEIPVINLKTSPQQKMPVCSFNGS
TPITRSTGDWTETFTEGKPVKGYLSSTKEAGGKGVPDSSQPISGSGAATVEVTLPDLRGT
WPNSVLGEVTEVDSSGESDDTVIEDTTENPSVKNNKVLPEKSDSLPSAAVKTSERENKET
TSHETVRSEMYENSEQQQAHAETPTQRSLEGQMSPQVPNMLNEVIPENLAMTDTTRVCSA
APPSVLSETGFSLTVPASAKSESLLGKNVEDTDGSSPEDLMAALTGTEEKGTVDKEKGDV
LEAVLEKIANVKNTLPVELLHENKLSSSETKNTKSKYSEHSRETNGGAPKVSSDLEQEQL
TIRAIKELGAKQVQAERMSPGGKLKRTFDPQSGPQNSSDILEHTDITTGSDLGIPKKPTI
IKDTRIDSISSLTKTETVNKHVLARLLSDFPVHDLIFWRDVKKTGFVFGTTLIMLLSLAA
FSVISVVSYLILALLSVTISFRVYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHSYMN
AAMVHVNKALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLVFSVPI
VYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE
NT seq 2823 nt   +upstreamnt  +downstreamnt
atggcggagtcatcggcggccactcagtctccgtcagtctcctcgtcgtcctccggggcc
gagccgtcaacgcttggcggcggcggcgggagccctggagcctgccccgccctgggggcg
aagagctgcggctcctcctgtgcggtgggattgagctctctttgctctgatgagccacca
tcaaaaattatgacttcctcctttctttcatcttctgaaatatataaccctgaccctaca
acaccacttggaagtgaaacattaggcagccatcttgtagctaaagacggaaaagatccc
ttggttcttctagataagaaaactctggactcacctcaggggaccaacaaggacagagta
gacactccggtttctcttgcagctgacattccttgcagccacccttctattccagacagt
ttcccagaacaacctacttttctttcaaaggaaactgatccaacagaagagtgggtagtt
aaaaaccaagaacccaagaacccaagtgaagttccaagtggagaggacagaagtgcactg
gatcttgggcagcgtaaggcagaacacatttgtacacattccttgtctccatctgaacct
gcagtagccagtgtagaaaaagattctcctgagtcaccatttgaagtaattattgacaaa
gcaacatttgacagagaatttaaagatttgtataaggaaagcacagatgatttgggtggc
tgggcagctcacggtgacagagaatccccagcagatttattggaaatgaatgacaaagtg
tttccactgagaaataaagaggcagggcgttacccatcctctgcactgctcggtagacaa
ttctcacacactacagcagcactggaagaagtgtctagatgtgtgaatgatatgcataac
tttactaatgaaatactgacttgggacttagatccccaagcaaaacaacaggcggacaaa
tcaccttgcaccacagaaagtacaggactagacaggagtgaacatcgctcagaaattcca
gttataaatcttaaaacaagccctcaacagaaaatgcctgtatgttcttttaatgggagc
actcccattactagatccacaggtgactggacagaaacatttacagaaggaaaacctgta
aaaggctacctcagctccacaaaagaagctggtggcaaaggtgtaccagacagttctcag
cctatctcaggctctggagcagccacagtggaagtgactttacctgacctgaggggtacc
tggcctaactctgtgctaggggaagtcacagaggttgatagttctggggaatctgatgac
acagtaatagaggacaccacagaaaatccctcagttaagaacaacaaagttttgccagaa
aaatctgactcccttccaagtgctgctgtaaaaacaagtgaaagggaaaacaaagagact
accagtcatgaaactgtgaggagtgaaatgtatgaaaactctgagcagcagcaggcccat
gcagaaactcctactcagaggagtctggaaggtcagatgtctccacaagtacctaatatg
ctgaatgaagtcatacctgaaaatcttgctatgactgacacaaccagagtttgctcagca
gcacctccaagtgttcttagtgagactggattctcactaactgtgccagcttctgccaag
tcagaatctttgcttggaaaaaatgttgaagatacagatggttcctctccagaggacttg
atggctgccctcacaggaactgaggagaaggggacagtggataaagagaaaggtgatgtt
ttggaagcagtgttagagaagatagcaaacgttaaaaacactttgcctgtggaactcttg
catgaaaataagctaagtagttctgaaaccaaaaatactaaaagcaaatacagtgaacac
agcagagaaacaaatggaggtgcccccaaggtgtcttccgacttagagcaggagcagctc
accattagagccattaaagaattaggggctaagcaggtgcaggctgaaagaatgtctcct
ggaggaaaactcaagcgaacctttgatccacagtctgggccacagaattcatctgacatc
ctagaacacacagatatcacaactggatctgatcttgggattcccaaaaagcctactatc
atcaaagacactagaatagattctatttccagccttaccaagactgaaacagttaacaag
catgttctagcaagacttctcagtgatttcccagtgcatgatctgattttctggcgagat
gtgaagaagactgggtttgtctttggcaccacgctgatcatgctgctctctctggcagct
ttcagtgttatcagtgtggtctcttacctcatcctggctctactctctgtcaccatcagc
ttcagagtctacaagtctgtcatccaagctgtgcagaagtcagaagaaggacatccattc
aaggcctacctggatgtggacattacactgtcctcagaagctttccacagctacatgaat
gctgcaatggtgcatgtcaacaaggccctcaaactcattattcgtctctttctggtagaa
gacttggttgactccttgaagctggctgtcttcatgtggctgatgacctacgtcggtgct
gtttttaacggaattacccttctgattctcgccgagctgctggttttcagcgtcccaatt
gtctatgagaagtataagacacagattgaccactatgttgggattgcccgggatcagacc
aagtcaattgttgaaaagatccaagcaaagcttcctggaatcgccaaaaaaaaggcagaa
taa

KEGG   Rattus norvegicus (rat): 83765
Entry
83765             CDS       T01003                                 
Symbol
Rtn4
Name
(RefSeq) reticulon-4
  KO
K20720  reticulon-4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    83765 (Rtn4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    83765 (Rtn4)
   03036 Chromosome and associated proteins [BR:rno03036]
    83765 (Rtn4)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    83765 (Rtn4)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation proteins
   Spindle formation proteins
    83765 (Rtn4)
SSDB
Motif
Pfam: Reticulon DUF639
Other DBs
NCBI-GeneID: 83765
NCBI-ProteinID: NP_114019
RGD: 620989
Ensembl: ENSRNOG00000004621
UniProt: Q9JK11
LinkDB
Position
14:103450074..103497687
AA seq 1163 aa
MEDIDQSSLVSSSTDSPPRPPPAFKYQFVTEPEDEEDEEEEEDEEEDDEDLEELEVLERK
PAAGLSAAAVPPAAAAPLLDFSSDSVPPAPRGPLPAAPPAAPERQPSWERSPAAPAPSLP
PAAAVLPSKLPEDDEPPARPPPPPPAGASPLAEPAAPPSTPAAPKRRGSGSVDETLFALP
AASEPVIPSSAEKIMDLMEQPGNTVSSGQEDFPSVLLETAASLPSLSPLSTVSFKEHGYL
GNLSAVSSSEGTIEETLNEASKELPERATNPFVNRDLAEFSELEYSEMGSSFKGSPKGES
AILVENTKEEVIVRSKDKEDLVCSAALHSPQESPVGKEDRVVSPEKTMDIFNEMQMSVVA
PVREEYADFKPFEQAWEVKDTYEGSRDVLAARANVESKVDRKCLEDSLEQKSLGKDSEGR
NEDASFPSTPEPVKDSSRAYITCASFTSATESTTANTFPLLEDHTSENKTDEKKIEERKA
QIITEKTSPKTSNPFLVAVQDSEADYVTTDTLSKVTEAAVSNMPEGLTPDLVQEACESEL
NEATGTKIAYETKVDLVQTSEAIQESLYPTAQLCPSFEEAEATPSPVLPDIVMEAPLNSL
LPSAGASVVQPSVSPLEAPPPLSYDSIKLEPENPPPYEEAMNVALKALGTKEGIKEPESF
NAAVQETEAPYISIACDLIKETKLSTEPSPDFSNYSEIAKFEKSVPEHAELVEDSSPESE
PVDLFSDDSIPEVPQTQEEAVMLMKESLTEVSETVAQHKEERLSASPQELGKPYLESFQP
NLHSTKDAASNDIPTLTKKEKISLQMEEFNTAIYSNDDLLSSKEDKIKESETFSDSSPIE
IIDEFPTFVSAKDDSPKLAKEYTDLEVSDKSEIANIQSGADSLPCLELPCDLSFKNIYPK
DEVHVSDEFSENRSSVSKASISPSNVSALEPQTEMGSIVKSKSLTKEAEKKLPSDTEKED
RSLSAVLSAELSKTSVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLS
VTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKELRRL
FLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSIPVIYERHQVQIDHYLGLA
NKSVKDAMAKIQAKIPGLKRKAD
NT seq 3492 nt   +upstreamnt  +downstreamnt
atggaagacatagaccagtcgtcgctggtctcctcgtccacggacagcccgccccggcct
ccgcccgccttcaagtaccagttcgtgacggagcccgaggacgaggaggacgaggaggag
gaggaggacgaggaggaggacgacgaggacctagaggaactggaggtgctggagaggaag
cccgcagccgggctgtccgcagctgcggtgccgcccgccgccgccgcgccgctgctggac
ttcagcagcgactcggtgccccccgcgccccgcgggccgctgccggccgcgccccctgcc
gctcctgagaggcagccatcctgggaacgcagccccgcggcgcccgcgccatccctgccg
cccgctgccgcagtcctgccctccaagctcccagaggacgacgagcctccggcgaggccc
ccgcctccgccgccagccggcgcgagccccctggcggagcccgccgcgcccccttccacg
ccggccgcgcccaagcgcaggggctccggctcagtggatgagaccctttttgctcttcct
gctgcatctgagcctgtgataccctcctctgcagaaaaaattatggatttgatggagcag
ccaggtaacactgtttcgtctggtcaagaggatttcccatctgtcctgcttgaaactgct
gcctctcttccttctctatctcctctctcaactgtttcttttaaagaacatggatacctt
ggtaacttatcagcagtgtcatcctcagaaggaacaattgaagaaactttaaatgaagct
tctaaagagttgccagagagggcaacaaatccatttgtaaatagagatttagcagaattt
tcagaattagaatattcagaaatgggatcatcttttaaaggctccccaaaaggagagtca
gccatattagtagaaaacactaaggaagaagtaattgtgaggagtaaagacaaagaggat
ttagtttgtagtgcagcccttcacagtccacaagaatcacctgtgggtaaagaagacaga
gttgtgtctccagaaaagacaatggacatttttaatgaaatgcagatgtcagtagtagca
cctgtgagggaagagtatgcagactttaagccatttgaacaagcatgggaagtgaaagat
acttatgagggaagtagggatgtgctggctgctagagctaatgtggaaagtaaagtggac
agaaaatgcttggaagatagcctggagcaaaaaagtcttgggaaggatagtgaaggcaga
aatgaggatgcttctttccccagtaccccagaacctgtgaaggacagctccagagcatat
attacctgtgcttcctttacctcagcaaccgaaagcaccacagcaaacactttccctttg
ttagaagatcatacttcagaaaataaaacagatgaaaaaaaaatagaagaaaggaaggcc
caaattataacagagaagactagccccaaaacgtcaaatcctttccttgtagcagtacag
gattctgaggcagattatgttacaacagataccttatcaaaggtgactgaggcagcagtg
tcaaacatgcctgaaggtctgacgccagatttagttcaggaagcatgtgaaagtgaactg
aatgaagccacaggtacaaagattgcttatgaaacaaaagtggacttggtccaaacatca
gaagctatacaagaatcactttaccccacagcacagctttgcccatcatttgaggaagct
gaagcaactccgtcaccagttttgcctgatattgttatggaagcaccattaaattctctc
cttccaagcgctggtgcttctgtagtgcagcccagtgtatccccactggaagcacctcct
ccacttagttatgacagtataaagcttgagcctgaaaaccccccaccatatgaagaagcc
atgaacgtagcactaaaagctttgggaacaaaggaaggaataaaagagcctgaaagtttt
aatgcagctgttcaggaaacagaagctccttatatatccattgcgtgtgatttaattaaa
gaaacaaagctctccactgagccaagtccagatttctctaattattcagaaatagcaaaa
ttcgagaagtcggtgcccgaacacgctgagctagtggaggattcctcacctgaatctgaa
ccagttgacttatttagtgatgattcgattcctgaagtcccacaaacacaagaggaggct
gtgatgctcatgaaggagagtctcactgaagtgtctgagacagtagcccagcacaaagag
gagagacttagtgcctcacctcaggagctaggaaagccatatttagagtcttttcagccc
aatttacatagtacaaaagatgctgcatctaatgacattccaacattgaccaaaaaggag
aaaatttctttgcaaatggaagagtttaatactgcaatttattcaaatgatgacttactt
tcttctaaggaagacaaaataaaagaaagtgaaacattttcagattcatctccgattgag
ataatagatgaatttcccacgtttgtcagtgctaaagatgattctcctaaattagccaag
gagtacactgatctagaagtatccgacaaaagtgaaattgctaatatccaaagcggggca
gattcattgccttgcttagaattgccctgtgacctttctttcaagaatatatatcctaaa
gatgaagtacatgtttcagatgaattctccgaaaataggtccagtgtatctaaggcatcc
atatcgccttcaaatgtctctgctttggaacctcagacagaaatgggcagcatagttaaa
tccaaatcacttacgaaagaagcagagaaaaaacttccttctgacacagagaaagaggac
agatccctgtcagctgtattgtcagcagagctgagtaaaacttcagttgttgacctcctc
tactggagagacattaagaagactggagtggtgtttggtgccagcttattcctgctgctg
tctctgacagtgttcagcattgtcagtgtaacggcctacattgccttggccctgctctcg
gtgactatcagctttaggatatataagggcgtgatccaggctatccagaaatcagatgaa
ggccacccattcagggcatatttagaatctgaagttgctatatcagaggaattggttcag
aaatacagtaattctgctcttggtcatgtgaacagcacaataaaagaactgaggcggctt
ttcttagttgatgatttagttgattccctgaagtttgcagtgttgatgtgggtgtttact
tatgttggtgccttgttcaatggtctgacactactgattttagctctgatctcactcttc
agtattcctgttatttatgaacggcatcaggtgcagatagatcattatctaggacttgca
aacaagagtgttaaggatgccatggccaaaatccaagcaaaaatccctggattgaagcgc
aaagcagattga

DBGET integrated database retrieval system