KEGG   Rattus norvegicus (rat): 24189
Entry
24189             CDS       T01003                                 

Gene name
Aldoa
Definition
(RefSeq) fructose-bisphosphate aldolase A
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00030  Pentose phosphate pathway
rno00051  Fructose and mannose metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01230  Biosynthesis of amino acids
rno04066  HIF-1 signaling pathway
Module
rno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rno_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    24189 (Aldoa)
   00030 Pentose phosphate pathway
    24189 (Aldoa)
   00051 Fructose and mannose metabolism
    24189 (Aldoa)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    24189 (Aldoa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    24189 (Aldoa)
   03036 Chromosome and associated proteins [BR:rno03036]
    24189 (Aldoa)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24189 (Aldoa)
Enzymes [BR:rno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     24189 (Aldoa)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    24189 (Aldoa)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    24189 (Aldoa)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   24189 (Aldoa)
SSDB
Motif
Pfam: Glycolytic
Other DBs
NCBI-GeneID: 24189
NCBI-ProteinID: NP_001170776
RGD: 2089
Ensembl: ENSRNOG00000052802
UniProt: P05065
LinkDB
Position
1
AA seq 364 aa
MPHPYPALTPEQKKELADIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYR
QLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTN
GETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSSLAIMENANVLARYASICQQ
NGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHAC
TQKFSNEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASINLNAINKCPLLKPWALTF
SYGRALQASALKAWGGKKENLKAAQEEYIKRALANSLACQGKYTPSGQSGAAASESLFIS
NHAY
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgccccacccatacccagcactgaccccggagcagaagaaggagctggctgacatcgct
caccgaattgtagctccgggcaagggcatcctggctgcagacgagtccactggaagcatt
gccaagcgcctgcagtccattggcaccgagaacaccgaggagaacaggcgcttctaccgc
caactgctgctgactgccgatgaccgtgtgaatccctgcattggaggggtgatccttttc
cacgagacactgtaccagaaggcagatgatggccgtcccttcccccaagttatcaagtcc
aagggtggtgttgtgggcattaaggtagataagggtgtagtgcccctggctggaaccaat
ggcgagaccactactcaagggctggacgggctgtctgagcgctgtgcccagtataagaag
gatggagccgactttgccaagtggcgctgtgtgctaaagattggggagcatactccctcg
tccctcgccatcatggaaaatgccaatgttctggcccgttacgccagcatctgccagcag
aatggcattgtacccattgtggagcctgaaattctccctgatggggaccatgacttgaag
cgctgccagtatgtaactgagaaggtactggcagctgtctacaaggctctgagtgaccac
catgtctatctggaaggcacactgctgaagcccaacatggtcacccctggccatgcttgc
acccagaaattttccaatgaggaaattgccatggcaaccgtcacagcacttcgtcgaaca
gtgccccctgccgtccctggggtcactttcctgtctggagggcagagtgaggaagaggca
tccatcaacctcaatgctatcaacaagtgtcccctgctgaagccatgggccttgactttc
tcctatggccgagccctgcaggcctctgctctaaaggcttggggtgggaagaaggagaac
ctgaaggcagcccaggaggagtacatcaagcgagccctggccaacagcctcgcttgtcaa
ggaaagtacactccaagtggccagtctggagccgcagccagtgaatctctcttcatctct
aaccatgcctactaa

KEGG   Rattus norvegicus (rat): 24190
Entry
24190             CDS       T01003                                 

Gene name
Aldob
Definition
(RefSeq) fructose-bisphosphate aldolase B
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00030  Pentose phosphate pathway
rno00051  Fructose and mannose metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01230  Biosynthesis of amino acids
rno04066  HIF-1 signaling pathway
Module
rno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rno_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    24190 (Aldob)
   00030 Pentose phosphate pathway
    24190 (Aldob)
   00051 Fructose and mannose metabolism
    24190 (Aldob)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    24190 (Aldob)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    24190 (Aldob)
   03036 Chromosome and associated proteins [BR:rno03036]
    24190 (Aldob)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24190 (Aldob)
Enzymes [BR:rno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     24190 (Aldob)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    24190 (Aldob)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    24190 (Aldob)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   24190 (Aldob)
SSDB
Motif
Pfam: Glycolytic
Other DBs
NCBI-GeneID: 24190
NCBI-ProteinID: NP_036628
RGD: 2090
Ensembl: ENSRNOG00000006807
UniProt: Q66HT1
LinkDB
Position
5
AA seq 364 aa
MAHRFPALTSEQKKELSEIAQRIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFR
ELLFSVDNSISQSIGGVILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTN
KETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRISDQCPSSLAIQENANALARYASICQQ
NGLVPIVEPEVLPDGDHDLEHCQYVSEKVLAAVYKALNDHHVYLEGTLLKPNMVTAGHAC
TKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINRCPLPRPWKLSF
SYGRALQASALAAWGGKAANKKATQEAFMKRAVANCQAAQGQYVHTGSSGAASTQSLFTA
SYTY
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggctcaccgatttccagccctcacctcagagcagaagaaggagctctccgagattgcg
cagcgcattgttgccaatgggaagggtatcctggctgcagatgagtctgtgggcaccatg
ggaaaccgcctacagaggataaaggtggaaaacactgaagagaaccgaaggcagttccga
gagctcctctttagtgtggacaattctatcagccagagcatcggcggagtgatccttttc
catgagacgctctaccagaaggacagccagggaaagctgttcagaaacattctcaaggag
aagggaattgtggtgggcatcaagctggaccaaggaggtgccccgcttgcaggaacaaac
aaagaaaccaccattcaagggcttgacggcctctccgaacgctgtgctcagtacaagaaa
gacggagtcgactttgggaagtggcgtgctgtgctgaggatctcggaccagtgcccttcc
agccttgctatccaagaaaacgccaacgctctggctcgctacgccagcatctgccagcag
aatgggctggtacctattgttgagccagaggttcttcctgatggagaccatgacctagag
cactgccagtatgtttctgagaaggtcctggctgctgtctacaaggctctcaatgatcat
catgtttaccttgagggcaccctgctaaagccaaacatggtgactgctggacatgcctgc
accaagaagtacacacctgagcaagtggctatggccaccgtcacggctctccacagaact
gttcctgcagctgtgcctggtatctgctttttgtctggaggcatgagtgaggaggatgct
acacttaacctcaatgctatcaaccgttgccctctacctaggccctggaaactaagcttt
tcatacggcagagccctccaggccagtgcattggctgcctggggcggcaaggctgcaaac
aagaaggcaacccaggaagctttcatgaagcgggctgtggccaactgccaggcagcccaa
ggacagtatgttcacacgggctcgtcaggcgctgcttccacgcagtcactcttcacagcc
tcctacacctactag

KEGG   Rattus norvegicus (rat): 24191
Entry
24191             CDS       T01003                                 

Gene name
Aldoc
Definition
(RefSeq) fructose-bisphosphate aldolase C
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00030  Pentose phosphate pathway
rno00051  Fructose and mannose metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01230  Biosynthesis of amino acids
rno04066  HIF-1 signaling pathway
Module
rno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rno_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    24191 (Aldoc)
   00030 Pentose phosphate pathway
    24191 (Aldoc)
   00051 Fructose and mannose metabolism
    24191 (Aldoc)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    24191 (Aldoc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    24191 (Aldoc)
   03036 Chromosome and associated proteins [BR:rno03036]
    24191 (Aldoc)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24191 (Aldoc)
Enzymes [BR:rno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     24191 (Aldoc)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    24191 (Aldoc)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    24191 (Aldoc)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   24191 (Aldoc)
SSDB
Motif
Pfam: Glycolytic
Other DBs
NCBI-GeneID: 24191
NCBI-ProteinID: NP_036629
RGD: 2091
Ensembl: ENSRNOG00000011452
UniProt: P09117
LinkDB
Position
10
AA seq 363 aa
MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYR
QVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQEKGILVGIKVDKGVVPLAGTD
GETTTQGLDGLLERCAQYKKDGADFAKWRCVLKISDRTPSALAILENANVLARYASICQQ
NGIVPIVEPEILPDGDHDLKRCQFVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHAC
PIKYSPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASLNLNAINRCSLPRPWALTF
SYGRALQASALSAWRGQRDNAGAATEEFIKRAEMNGLAAQGKYEGSGDGGAAAQSLYVAN
HAY
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgccccactcatacccagccctttctgctgagcagaagaaggagttgtcggatattgct
ctgaggattgtggccccaggcaagggcattctggctgcagatgagtccgtgggcagcatg
gccaaaaggctgagccaaattggggtagagaacactgaggagaatcgccgactgtaccgc
caggtcctgttcagtgctgatgaccgtgtgaaaaagtgcattgggggggtcatcttcttc
cacgagacactctaccagaaagatgacaatggtgtcccctttgtccgcaccatccaggag
aagggcattctcgtaggcatcaaggttgacaagggtgtagtgcctctagctgggactgat
ggagaaaccaccactcaagggctggatggactcttggaacgctgtgctcagtataagaag
gacggtgctgattttgccaaatggcgctgtgtgctgaaaatcagtgatcgcacaccctcg
gcactggccatactggagaatgccaatgtgctggcccgctatgccagcatctgccagcag
aatggtatcgtgcccatcgtggagcctgagatcctgcctgatggagaccatgacctcaaa
cgttgccagtttgttacagagaaggtcctggctgctgtgtacaaggccttgagtgatcat
cacgtatacctggaagggactctcctcaagcccaacatggtgacccctggccatgcctgt
cccatcaaatatagcccagaagagatcgccatggcaactgtcactgccctgcgtcgaact
gtgcccccagctgtcccaggggtgactttcctgtctgggggtcagagtgaagaggaggca
tcactcaacctcaatgccatcaaccgatgctcacttccccggccctgggccctcaccttc
tcctacggacgtgccctgcaggcatctgcactcagtgcctggagaggacaaagggataat
gctggggctgctactgaggagtttatcaagcgggccgagatgaacgggcttgcagcccag
ggcaaatatgaaggcagtggagatggtggagcagcagcacagtccctctacgtggccaac
catgcctactga

KEGG   Rattus norvegicus (rat): 299052
Entry
299052            CDS       T01003                                 

Gene name
Aldoart2
Definition
(RefSeq) fructose-bisphosphate aldolase
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00030  Pentose phosphate pathway
rno00051  Fructose and mannose metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01230  Biosynthesis of amino acids
rno04066  HIF-1 signaling pathway
Module
rno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rno_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    299052 (Aldoart2)
   00030 Pentose phosphate pathway
    299052 (Aldoart2)
   00051 Fructose and mannose metabolism
    299052 (Aldoart2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    299052 (Aldoart2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    299052 (Aldoart2)
   03036 Chromosome and associated proteins [BR:rno03036]
    299052 (Aldoart2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    299052 (Aldoart2)
Enzymes [BR:rno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     299052 (Aldoart2)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    299052 (Aldoart2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    299052 (Aldoart2)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   299052 (Aldoart2)
SSDB
Motif
Pfam: Glycolytic
Other DBs
NCBI-GeneID: 299052
NCBI-ProteinID: NP_001013965
RGD: 1359133
Ensembl: ENSRNOG00000030869
UniProt: Q6AY07
LinkDB
Position
6
AA seq 364 aa
MPYPYLALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYR
QLLLTADDRVNSCIGGVILFHETLYQKTDDGRPFPQVIKSKGGVVGIKVDKGVVTLAGTD
GETTTQGLDDLSGRCAQYKQDGADFAKWRCVLKIGKHTPSALAILENANVLARYASICQQ
NGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHTC
TQKFSSEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASINLNAINKCPLLKPWALTF
SYGRALQASALKAWGGKEENKKAAQEEYIKRALANSLACQGKYTPSDESGAVASESLFIS
NHAY
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgccctacccatacctagcactgaccccggagcagaaaaaggagctgtctgacatcgct
caccgaattgtggctccgggcaagggcatcctggctgcagatgagtccaccggaagcatc
gccaagcggctgcagtccattggcaccgagaacaccgaggagaacaggcgcttctaccgt
cagctgctgctgactgccgatgaccgtgtgaattcctgcattgggggcgtgatccttttc
cacgagacactgtaccagaagacggatgatggccgtcccttcccccaagttatcaagtcc
aagggtggtgttgtgggcattaaggtggacaagggagtggtgaccctggcaggaactgac
ggcgagaccaccacccaagggctggatgacctgtctggacgctgtgctcagtacaagcag
gatggagccgattttgccaaatggcgttgcgtcctgaagattgggaaacacaccccctca
gcccttgccatcctggaaaatgccaatgttctggctcgttacgccagcatctgccagcag
aatggcattgtacccatcgtggagccagaaatcctccctgatggggaccatgacttgaag
cgctgtcagtatgtaactgagaaggtactggccgctgtctacaaggctctgagcgaccac
catgtctacctggaaggaaccttgctgaagcccaacatggtcaccccgggccatacttgc
actcagaaattttccagtgaagagattgctatggcaactgtcacagcgcttcgtcgcaca
gtgccccctgctgtccctggagtcactttcctgtctggagggcagagtgaggaagaggca
tccatcaacctcaatgctatcaacaagtgtcccttgctgaagccctgggccttgactttc
tcctatggtcgagccctgcaggcttctgccctaaaggcctggggtgggaaggaggagaac
aagaaggcagcccaggaggagtacatcaagcgagccctggccaacagcctcgcttgccaa
ggaaagtacaccccgagtgatgaatcaggggcggtggctagtgaatccctcttcatctct
aaccatgcctactga

DBGET integrated database retrieval system