KEGG   Rattus norvegicus (rat): 24451
Entry
24451             CDS       T01003                                 
Symbol
Hmox1
Name
(RefSeq) heme oxygenase 1
  KO
K00510  heme oxygenase 1 [EC:1.14.14.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00860  Porphyrin metabolism
rno01100  Metabolic pathways
rno04066  HIF-1 signaling pathway
rno04216  Ferroptosis
rno04978  Mineral absorption
rno05200  Pathways in cancer
rno05206  MicroRNAs in cancer
rno05208  Chemical carcinogenesis - reactive oxygen species
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    24451 (Hmox1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    24451 (Hmox1)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    24451 (Hmox1)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    24451 (Hmox1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24451 (Hmox1)
   05206 MicroRNAs in cancer
    24451 (Hmox1)
   05208 Chemical carcinogenesis - reactive oxygen species
    24451 (Hmox1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    24451 (Hmox1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    24451 (Hmox1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.18  heme oxygenase (biliverdin-producing)
     24451 (Hmox1)
SSDB
Motif
Pfam: Heme_oxygenase
Other DBs
NCBI-GeneID: 24451
NCBI-ProteinID: NP_036712
RGD: 2806
Ensembl: ENSRNOG00000014117
UniProt: P06762
Structure
LinkDB
Position
19:13466287..13474082
AA seq 289 aa
MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTA
LEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHE
VGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQ
LYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLTEEHKDQSPSQTEFLRQRP
ASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLATVAVGIYAM
NT seq 870 nt   +upstreamnt  +downstreamnt
atggagcgcccacagctcgacagcatgtcccaggatttgtccgaggccttgaaggaggcc
accaaggaggtgcacatccgtgcagagaattctgagttcatgaggaactttcagaagggt
caggtgtccagggaaggctttaagctggtgatggcctccttgtaccatatctatacggcc
ctggaagaggagatagagcgaaacaagcagaacccagtctatgccccactctacttccct
gaggagctgcaccgaagggctgccctagagcaggacatggccttctggtatgggccccac
tggcaggaggccatcccttacacaccagccacacagcactacgtaaagcgtctccacgag
gtgggaggtactcatcctgagctgctggtggcccacgcatatacccgctacctgggtgac
ctctcagggggtcaggtcctgaagaagattgcgcagaaggccatggccttgccaagctct
ggggaaggcctggcttttttcaccttcccgagcatcgacaaccccaccaagttcaaacag
ctctatcgtgctcgcatgaacactctggagatgacccccgaggtcaagcacagggtgaca
gaagaggctaagaccgccttcctgctcaacattgagctgtttgaggagctgcaggcactg
ctgacagaggaacacaaagaccagagtccctcacagacagagtttcttcgccagaggcct
gctagcctggttcaagatactacctctgcagagacgccccgaggaaaatcccagatcagc
actagttcatcccagacaccgctcctgcgatgggtcctcacactcagtttcctgttggcg
accgtggcagtgggaatttatgccatgtaa

DBGET integrated database retrieval system