KEGG   Rattus norvegicus (rat): 24476
Entry
24476             CDS       T01003                                 

Gene name
Iapp
Definition
(RefSeq) islet amyloid polypeptide precursor
  KO
K08039  islet amyloid polypeptide
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24476 (Iapp)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    24476 (Iapp)
SSDB
Motif
Pfam: Calc_CGRP_IAPP
Other DBs
NCBI-GeneID: 24476
NCBI-ProteinID: NP_036718
RGD: 2854
Ensembl: ENSRNOG00000012417
UniProt: P12969
LinkDB
Structure
PDB: 
2KJ7

Position
4
AA seq 93 aa
MRCISRLPAVLLILSVALGHLRATPVGSGTNPQVDKRKCNTATCATQRLANFLVRSSNNL
GPVLPPTNVGSNTYGKRNVAEDPNRESLDFLLL
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaggtgcatctccaggctgccagctgttctcctcatcctctcggtggcactcggccac
ttgagagctacacctgtcggaagtggtaccaaccctcaggtggacaaacggaagtgcaac
acagccacatgtgccacacaacgtctggcaaacttcttggttcgctccagcaacaacctt
ggtccagtcctcccaccaaccaatgtgggatccaatacatatgggaagaggaatgtggca
gaggatccaaatagggaatccctggatttcttactcctgtaa

DBGET integrated database retrieval system