KEGG   Rattus norvegicus (rat): 24817
Entry
24817             CDS       T01003                                 

Gene name
Hnf1a
Definition
(RefSeq) hepatocyte nuclear factor 1-alpha
  KO
K08036  transcription factor 1, hepatocyte nuclear factor 1-alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    24817 (Hnf1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    24817 (Hnf1a)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain POU
    24817 (Hnf1a)
SSDB
Motif
Pfam: HNF-1B_C HNF-1_N HNF-1A_C Homeodomain Telethonin Homeobox_KN
Other DBs
NCBI-GeneID: 24817
NCBI-ProteinID: NP_036801
RGD: 3828
Ensembl: ENSRNOG00000001183
UniProt: P15257
LinkDB
Structure
PDB: 
1LFB

Position
12
AA seq 628 aa
MVSKLSQLQTELLAALLESGLSKEALIQALGEPGPYLMVGDGPLDKGESCGGTRGDLTEL
PNGLGETRGSEDDTDDDGEDFAPPILKELENLSPEEAAHQKAVVESLLQEDPWRVAKMVK
SYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHA
GQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAE
CIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRHKLAMDTYNGPPPGPGPGPALP
AHSSPGLPTTTLSPSKVHGVRYGQSATSEAAEVPSSSGGPLVTVSAALHQVSPTGLEPSS
LLSTEAKLVSATGGPLPPVSTLTALHSLEQTSPGLNQQPQNLIMASLPGVMTIGPGEPAS
LGPTFTNTGASTLVIGLASTQAQSVPVINSMGSSLTTLQPVQFSQPLHPSYQQPLMPPVQ
SHVAQSPFMATMAQLQSPHALYSHKPEVAQYTHTSLLPQTMLITDTNLSTLASLTPTKQV
FTSDTEASSEPGLHEPSSPATTIHIPSQDPSNIQHLQPAHRLSTSPTVSSSSLVLYQSSD
SNGHSHLLPSNHGVIETFISTQMASSSQ
NT seq 1887 nt   +upstreamnt  +downstreamnt
atggtttctaagttgagccagctgcagacggagctcctggctgctctgctcgagtcgggc
ctgagcaaagaggctctgatccaggctctgggggagcccgggccctacctgatggttgga
gatggtcccctggacaagggggagtcctgcggtgggactcgaggggacctgaccgagctg
cccaatggcctgggggagacgcgtggctcggaagatgacacggatgacgatggggaagac
ttcgcgccacccattctgaaagagctggagaacctcagcccagaggaggcagcccaccag
aaagccgtggtggagtcacttcttcaggaggacccatggcgcgtggcaaagatggtcaag
tcgtacctgcagcaacacaacatcccccagcgggaggtggtggacactacgggtctcaac
cagtcccacctgtcccagcacctcaacaagggcacccccatgaagacgcagaagcgggcc
gcgctgtacacctggtacgtccgcaagcagcgagaggtggctcagcaattcacccacgcg
gggcagggcggactgattgaagagcccacaggtgatgagctgccaaccaaaaaggggcgg
aggaaccggttcaagtggggccccgcatcccagcagatcctgttccaggcttacgagagg
cagaagaaccccagcaaggaagagcgagagaccttggtggaggagtgcaatagggcggag
tgcatccagagaggggtgtcaccatcgcaggcccaggggctaggctccaaccttgtcacc
gaggtgcgtgtctacaactggtttgccaaccggcgcaaggaagaagcctttcggcataag
ctggccatggacacgtataacgggcctccacccgggccaggccccggccctgcgctacct
gcccacagttccccgggcctgcccacaaccaccctctctcccagtaaggtccacggtgtg
cggtatggacagtctgcaaccagcgaggcagctgaggtgccctccagcagcggaggtccc
ttagtcacagtgtctgcggccttacaccaagtgtcccccacaggcttggagcccagcagc
ctgctgagcaccgaggccaagctggtctcagccacggggggtcccctgcctcccgtcagc
accctgacagcactgcacagcttggagcagacgtctccaggtctcaaccagcagccgcag
aaccttatcatggcctcgctgcctggggtcatgaccatcggcccaggggagcccgcctcc
ctgggtcccacgttcactaacacgggtgcctctaccctggtcattggtctggcctccaca
caggcacagagcgtgccagtcatcaacagcatggggagcagcctgaccaccctgcagccg
gtccagttttcccagccactgcacccttcctatcagcagcctctcatgccccctgtacag
agccacgtggcccagagtcccttcatggcaaccatggcccagctgcagagcccccacgcc
ctgtacagccacaagcctgaggtggcccagtacacgcatacaagcctgcttccgcagacc
atgctgatcacagacaccaacctcagcacccttgccagcctcacgcccaccaagcaggtc
ttcacctcagacacagaggcctccagtgagcctgggcttcatgagccgtcgtctccagcc
acaaccattcacatccccagccaggacccgtcaaacatccagcacctgcagcctgctcac
cggctcagcaccagtcccacagtgtcctccagcagcctggtgttgtaccagagttctgac
tccaacgggcacagccacctgctgccatccaaccacggtgtcatcgagacttttatctcc
acccagatggcctcctcctcccagtaa

DBGET integrated database retrieval system