KEGG   Rattus norvegicus (rat): 25231
Entry
25231             CDS       T01003                                 

Gene name
Onecut1
Definition
(RefSeq) hepatocyte nuclear factor 6
  KO
K08026  one cut domain, family member 1 (hepatocyte nuclear factor 6)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    25231 (Onecut1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    25231 (Onecut1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25231 (Onecut1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain CUT
    25231 (Onecut1)
SSDB
Motif
Pfam: CUT Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 25231
NCBI-ProteinID: NP_073162
RGD: 2811
Ensembl: ENSRNOG00000008095
UniProt: P70512
LinkDB
Structure
PDB: 
2D5V

Position
8
AA seq 465 aa
MNAQLTMEAIGELHGVSHEPVPAPADLLGGSPHARSSVGHRGSHLPPAHPRSMGMASLLD
GGSGGSDYHHHHRAPEHSLAGPLHPTMTMACETPPGMSMPTTYTTLTPLQPLPPISTVSD
KFPHHHHHHHHHHHPHHHQRLAGNVSGSFTLMRDERGLASMNNLYTPYHKDVAGMGQSLS
PLSGSGLGSIHNSQQGLPHYAHPGAAMPTDKMLTPNGFEAHHPAMLGRHGEQHLTPTSAG
MVPINGLPPHHPHAHLNAQGHGQLLGTAREPNPSVTGAQVSNGSNSGQMEEINTKEVAQR
ITTELKRYSIPQAIFAQRVLCRSQGTLSDLLRNPKPWSKLKSGRETFRRMWKWLQEPEFQ
RMSALRLAACKRKEQEHGKDRGNTPKKPRLVFTDVQRRTLHAIFKENKRPSKELQITISQ
QLGLELSTVSNFFMNARRRSLDKWQDEGSSNSGNSSSSSSTCTKA
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgaacgcacagctgaccatggaggcgatcggcgagctgcacggggtgagccatgagccg
gtgcccgcccctgctgacctgctgggcgggagccctcacgcgcgcagctccgtggggcac
cgcggcagccacctgcctcccgctcacccgcgttccatgggcatggcgtcgctgctggac
ggcggcagcggaggcagcgattaccaccaccaccaccgcgcccctgagcacagcttggct
ggccccctgcaccccaccatgaccatggcctgtgaaactcccccaggtatgagcatgccc
accacctacaccaccttaacccctctgcagccgctgccgcccatctccaccgtgtccgac
aagttccctcaccaccatcaccaccaccatcaccaccaccacccacatcaccaccagcgc
ctggcgggcaacgtgagcggtagtttcacacttatgcgggatgagcgcgggctggcctcc
atgaataacctctataccccctaccacaaggacgtggctggcatgggccagagcctctcg
cccctctctggctcgggtctgggcagcattcacaactcccagcaaggacttccccactat
gctcatcccggcgcggctatgcccaccgacaagatgctcaccccaaatggctttgaagcc
caccaccctgccatgctcggtcgccacggggagcagcacctcacgcccacctcggccggc
atggtacccatcaacggccttcctccacaccatccccatgcccacctgaatgcccagggc
cacggacagctcctgggcacagcccgggagcccaacccttcggtgaccggcgcgcaggtc
agcaatggaagtaattcagggcagatggaagagatcaataccaaagaggtggctcagcgt
atcaccaccgagctcaaacgttacagcatcccacaggccatcttcgcgcagagggtgctc
tgccgttcccaggggaccctttcggacctgctgcgaaaccccaagccctggagcaaactc
aagtccggtcgggagactttccggaggatgtggaagtggctgcaggagccggagttccag
cgcatgtcggcgctccgcttagcagcctgcaaaaggaaagagcaagaacacgggaaggac
agaggcaacacccccaaaaagcccaggctggtcttcacagacgtccaacgtcggactcta
catgcaatattcaaggaaaataagcgtccgtccaaagaattacaaatcaccatttcccag
cagctggggttggagctgagcactgtcagcaacttcttcatgaatgcgagaaggaggagt
ctggacaaatggcaggacgagggcagctccaattcaggcaactcttcgtcttcatcaagc
acttgtaccaaagcatga

DBGET integrated database retrieval system