KEGG   Rattus norvegicus (rat): 252971
Entry
252971            CDS       T01003                                 

Gene name
Socs1
Definition
(RefSeq) suppressor of cytokine signaling 1
  KO
K04694  suppressor of cytokine signaling 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
rno04380  Osteoclast differentiation
rno04630  JAK-STAT signaling pathway
rno04910  Insulin signaling pathway
rno04917  Prolactin signaling pathway
rno04930  Type II diabetes mellitus
rno04935  Growth hormone synthesis, secretion and action
rno05145  Toxoplasmosis
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    252971 (Socs1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    252971 (Socs1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    252971 (Socs1)
   04917 Prolactin signaling pathway
    252971 (Socs1)
   04935 Growth hormone synthesis, secretion and action
    252971 (Socs1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    252971 (Socs1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    252971 (Socs1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    252971 (Socs1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    252971 (Socs1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    252971 (Socs1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     252971 (Socs1)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 252971
NCBI-ProteinID: NP_665886
RGD: 69272
Ensembl: ENSRNOG00000002568
UniProt: G3V6B4
LinkDB
Position
10
AA seq 212 aa
MVARNQVAADNAISPASEPRRRPEPSSSSSSSSPAAPARPRPCPVVPAPAPGDTHFRTFR
SHSDYRRITRTSALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKM
ASGPTSIRVHFQAGRFHLDGSRETFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCR
QRIVAAVGRENLARIPLNPVLRDYLSSFPFQI
NT seq 639 nt   +upstreamnt  +downstreamnt
atggtagcacgtaaccaggtggcagccgacaatgcgatctccccggcatcagagccccga
cggcggccagagccatcctcgtcctcgtcttcgtcctcgccggcggccccggcgcgtccc
cggccctgcccggtggtcccggccccggctccgggcgacactcacttccgcaccttccgc
tcccactctgattaccggcgcatcacgcggaccagcgctctcctggacgcctgcggcttc
tactggggacccctgagcgtgcatggggcgcacgaacggctgcgtgccgagcccgtgggc
accttcttggtgcgcgacagtcgccagcggaactgcttcttcgcgctcagcgtgaagatg
gcttcgggccccacgagcattcgtgtgcacttccaggccggccgcttccacctggacggc
agccgcgagaccttcgactgcctcttcgagctgctggagcactacgtggcggcgccgcgc
cgcatgttgggggccccactgcgccagcgccgcgtgcggccgctgcaggagctgtgtcgc
cagcgcatcgtggccgccgtgggtcgcgagaacctggcacgcatccctcttaacccggta
ctccgtgactacctgagttccttccccttccagatctga

KEGG   Rattus norvegicus (rat): 305828
Entry
305828            CDS       T01003                                 

Gene name
Socs4
Definition
(RefSeq) suppressor of cytokine signaling 4
  KO
K04697  suppressor of cytokine signaling 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04630  JAK-STAT signaling pathway
rno04910  Insulin signaling pathway
rno04917  Prolactin signaling pathway
rno04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    305828 (Socs4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    305828 (Socs4)
   04917 Prolactin signaling pathway
    305828 (Socs4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    305828 (Socs4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    305828 (Socs4)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     305828 (Socs4)
SSDB
Motif
Pfam: SOCS SOCS_box SH2
Other DBs
NCBI-GeneID: 305828
NCBI-ProteinID: NP_001100726
RGD: 1306503
Ensembl: ENSRNOG00000011377
UniProt: B5DF08
LinkDB
Position
15
AA seq 436 aa
MAENNSKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSRKSESCSESEAVGTLESVEIPLR
SQERELSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIRNCGARHSPGLPSKRTIH
ISELMLDKCPFPPPSDLAFRWHFIKRHTVALSSSSDEWVSTDLCERRPRDAQLKRRSTED
DIPCFSHTSVQPCVITTNSASCAGGHVTGSLMNLVTDNSMEDGDMDSEDEIITLCTSSRK
RNKPRWETDDGILQLEAPPKFHTQIDYVHCLVPDLLQISNNPCYWGVMDKYAAEALLEGK
PEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGLLEH
YKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSPMKLYLKEYH
YKSKVRLLRIDVPEPQ
NT seq 1311 nt   +upstreamnt  +downstreamnt
atggctgaaaacaatagtaaaaatgtagatgtgcggcctaaaacaagtcggagtagaagt
gctgacaggaaggacggttatgtgtggagtggaaagaagttatcttggtccagaaagagt
gagagctgttctgagtctgaggccgtaggtactcttgagagcgttgaaatccctctgagg
agccaggaaagggaacttagctgttcgtccattgagttggacttggatcattcctgtggg
catagatttttaggccgatcccttaaacagaaactgcaagatgccgtggggcagtgtttt
cctataaggaactgtggtgctcgccactctccagggcttccatctaaaagaacgattcac
atcagtgagctcatgctagacaagtgccctttcccacctccatcagacttagcctttagg
tggcattttattaaacggcacactgttgctctgagttccagttcagatgaatgggtgagc
acagacctgtgtgagaggaggccgagagatgctcagctgaaacgaagaagcacagaagac
gacataccctgtttctcacataccagtgtccagccgtgtgtcataactaccaacagtgct
tcatgtgcaggtggtcatgtgaccggttctctgatgaacttggtcaccgacaatagcatg
gaagacggtgatatggactcagaggatgaaattataacactgtgcacaagctccaggaaa
aggaacaagcccagatgggaaacggatgacggcatcctgcaattggaggcacctcctaag
ttccacacccagattgattacgtgcactgccttgtcccagacctcctccagatcagtaac
aacccgtgctactggggggttatggacaaatacgcagccgaggctctgctagaaggaaag
ccagagggcacctttttacttcgagattcagcccaggaagattatttattctctgttagt
tttaggcgctacagtcgttctcttcacgctagaattgaacagtggaatcataacttcagc
tttgacgcccacgatccctgtgtcttccattctcccgatattactgggctcctagagcat
tataaggacccaagtgcctgcatgttctttgagccacttttatccactccgttaatccgg
actttccccttttccttgcagcacatttgcaggacagttatttgtaactgtacaacgtac
gatggcatcgatgcccttccaattccttctcctatgaaattgtacctgaaggaataccat
tacaaatcaaaagttaggctactcaggattgacgtgccagagccacagtga

KEGG   Rattus norvegicus (rat): 84607
Entry
84607             CDS       T01003                                 

Gene name
Socs2
Definition
(RefSeq) suppressor of cytokine signaling 2
  KO
K04695  suppressor of cytokine signaling 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04630  JAK-STAT signaling pathway
rno04910  Insulin signaling pathway
rno04917  Prolactin signaling pathway
rno04930  Type II diabetes mellitus
rno04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    84607 (Socs2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    84607 (Socs2)
   04917 Prolactin signaling pathway
    84607 (Socs2)
   04935 Growth hormone synthesis, secretion and action
    84607 (Socs2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    84607 (Socs2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    84607 (Socs2)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     84607 (Socs2)
SSDB
Motif
Pfam: SH2 SOCS_box SH2_2 Condensation
Other DBs
NCBI-GeneID: 84607
NCBI-ProteinID: NP_478115
RGD: 69273
UniProt: O88582
LinkDB
Position
7
AA seq 198 aa
MTLRCLEPSGNGADRTRSQWGTAGSPEDQSPEAARLAKALRELSQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPTLQHFCRLSINKCTGTIRG
LPLPTRLKDYLEEYKFQV
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaccctgcggtgcctggagccctctgggaatggcgcggacaggacacggagccagtgg
gggacagcggggtcgccggaggatcagtccccggaggcggcgcgtctggcgaaggccctg
cgtgagctcagtcaaacaggatggtactggggaagtatgactgttaatgaagccaaagag
aaattaaaagaggcgccagaaggaactttcttgattagagatagctcccactcagactac
ctattaaccatatctgttaagacatcagccgggccgactaacctgcggattgagtaccaa
gacgggaaattcagattggattctatcatatgtgtcaagtccaagcttaagcagtttgac
agcgtggttcatctgattgactactacgttcagatgtgcaaggacaaacggacaggccct
gaagccccccggaatgggactgttcacctttacctgaccaaacctctgtatacatcagca
ccgacgctgcagcacttctgccgactcagcattaacaagtgtaccggtaccatccgggga
ctacctttaccaacaagactgaaagattacttggaagagtataaattccaggtataa

KEGG   Rattus norvegicus (rat): 89829
Entry
89829             CDS       T01003                                 

Gene name
Socs3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
rno04380  Osteoclast differentiation
rno04630  JAK-STAT signaling pathway
rno04668  TNF signaling pathway
rno04910  Insulin signaling pathway
rno04917  Prolactin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno04935  Growth hormone synthesis, secretion and action
rno05160  Hepatitis C
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    89829 (Socs3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    89829 (Socs3)
   04668 TNF signaling pathway
    89829 (Socs3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    89829 (Socs3)
   04920 Adipocytokine signaling pathway
    89829 (Socs3)
   04917 Prolactin signaling pathway
    89829 (Socs3)
   04935 Growth hormone synthesis, secretion and action
    89829 (Socs3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    89829 (Socs3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    89829 (Socs3)
   05164 Influenza A
    89829 (Socs3)
   05168 Herpes simplex virus 1 infection
    89829 (Socs3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    89829 (Socs3)
   04932 Non-alcoholic fatty liver disease
    89829 (Socs3)
   04931 Insulin resistance
    89829 (Socs3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    89829 (Socs3)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     89829 (Socs3)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 89829
NCBI-ProteinID: NP_446017
RGD: 621087
Ensembl: ENSRNOG00000002946
UniProt: O88583
LinkDB
Position
10
AA seq 225 aa
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVETQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGAPSFSLPPTEPSFEVQEQPPAQALPGGTPKRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 678 nt   +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg
cgcctcaagaccttcagctccaagagcgagtaccagctggtggtgaacgccgtgcgcaag
ctgcaggagagcggattctactggagtgccgtaaccggcggcgaggcgaacctgctgctc
agcgccgagcccgcgggcacctttcttatccgcgacagctcggaccagcgccacttcttc
acactgagcgtcgagacccagtcggggaccaagaacctacgcatccagtgcgaggggggc
agcttttcgctgcagagtgacccccggagcacgcagccagtgccccgctttgactgtgta
ctcaagttggtgcaccactacatgccgcccccaggggccccttccttttctttaccaccg
acggaaccttcctttgaggttcaggagcagccacctgcccaggcactccccgggggtacc
cccaagagagcttactacatctattctgggggcgagaagatcccgctggtactgagccga
cctctctcctccaacgtggctaccctccagcatctttgtcggaagactgtcaacggtcac
ctggactcctatgagaaagtgacccagctgcctggacccattcgggagttcctggaccag
tatgatgctccactttaa

DBGET integrated database retrieval system