KEGG   Rattus norvegicus (rat): 25467
Entry
25467             CDS       T01003                                 

Gene name
Irs1
Definition
(RefSeq) insulin receptor substrate 1
  KO
K16172  insulin receptor substrate 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04068  FoxO signaling pathway
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04722  Neurotrophin signaling pathway
rno04910  Insulin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno04935  Growth hormone synthesis, secretion and action
rno04960  Aldosterone-regulated sodium reabsorption
rno05010  Alzheimer disease
rno05206  MicroRNAs in cancer
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    25467 (Irs1)
   04022 cGMP-PKG signaling pathway
    25467 (Irs1)
   04151 PI3K-Akt signaling pathway
    25467 (Irs1)
   04152 AMPK signaling pathway
    25467 (Irs1)
   04150 mTOR signaling pathway
    25467 (Irs1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    25467 (Irs1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    25467 (Irs1)
   04923 Regulation of lipolysis in adipocytes
    25467 (Irs1)
   04920 Adipocytokine signaling pathway
    25467 (Irs1)
   04935 Growth hormone synthesis, secretion and action
    25467 (Irs1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    25467 (Irs1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    25467 (Irs1)
  09149 Aging
   04211 Longevity regulating pathway
    25467 (Irs1)
   04213 Longevity regulating pathway - multiple species
    25467 (Irs1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    25467 (Irs1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    25467 (Irs1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    25467 (Irs1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    25467 (Irs1)
   04932 Non-alcoholic fatty liver disease
    25467 (Irs1)
   04931 Insulin resistance
    25467 (Irs1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    25467 (Irs1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   25467 (Irs1)
SSDB
Motif
Pfam: IRS PH PH_11 SUIM_assoc
Other DBs
NCBI-GeneID: 25467
NCBI-ProteinID: NP_037101
RGD: 2922
Ensembl: ENSRNOG00000014597
UniProt: P35570
LinkDB
Position
9
AA seq 1235 aa
MASPPDTDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAP
KRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKAH
HDGAGGGCGGSCSGSSGVGEAGEDLSYDTGPGPAFKEVWQVILKPKGLGQTKNLIGIYRL
CLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQVDDSVV
AQNMHETILEAMRAMSDEFRPRSKSQSSSSCSNPISVPLRRHHLNNPPPSQVGLTRRSRT
ESITATSPASMVGGKPGSFRVRASSDGEGTMSRPASVDGSPVSPSTNRTHAHRHRGSSRL
HPPLNHSRSIPMPSSRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSASVSGSPSDGGF
ISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEELSNYICMGGKGASTLTAPNGHYIL
SRGGNGHRYIPGATMGTSPALTGDEAAGAADLDNRFRKRTHSAGTSPTISHQKTPSQSSV
VSIEEYTEMMPAAYPPGGGSGGRLPGYRHSAFVPTHSYPEEGLEMHHLERRGGHHRPDSS
NLHTDDGYMPMSPGVAPVPSNRKGNGDYMPMSPKSVSAPQQIINPIRRHPQRVDPNGYMM
MSPSGSCSPDIGGGSCSSSSISAAPSGSSYGKPWTNGVGGHHTHALPHAKPPVESGGGKL
LPCTGDYMNMSPVGDSNTSSPSECYYGPEDPQHKPVLSYYSLPRSFKHTQRPGEPEEGAR
HQHLRLSSSSGRLRYTATAEDSSSSTSSDSLGGGYCGARPESSVTHPHHHALQPHLPRKV
DTAAQTNSRLARPTRLSLGDPKASTLPRVREQQQQQQQQQQSSLHPPEPKSPGEYVNIEF
GSGQPGYLAGPATSRSSPSVRCLPQLHPAPREETGSEEYMNMDLGPGRRATWQESGGVEL
GRVGPAPPGAASICRPTRSVPNSRGDYMTMQIGCPRQSYVDTSPVAPVSYADMRTGIAAE
KVSLPRTTGAAPPPSSTASASASVTPQGAAEQAAHSSLLGGPQGPGGMSAFTRVNLSPNH
NQSAKVIRADTQGCRRRHSSETFSAPTRAGNTVSFGAGAAGGGSGGGSEDVKRHSSASFE
NVWLRPGDLGGASKESAPGYGAAGGLEKSLNYIDLDLVKDVKQHPQDCPSQQQSLPPPPP
HQPLGSNEGSSPRRSSEDLSTYASINFQKQPEDRQ
NT seq 3708 nt   +upstreamnt  +downstreamnt
atggcgagccctccggataccgatggcttctcagacgtgcgcaaggtgggttacctgcgc
aaacccaagagtatgcataagcgctttttcgtgctgcgggcggccagcgaggccgggggc
ccggcgcgcctggagtattatgagaacgagaagaagtggcggcacaagtcgagcgccccc
aaacgctcgatccccctcgagagctgtttcaacatcaacaagcgggctgactccaagaac
aagcacctggtggctctctacacccgagacgaacactttgccattgcggcggatagcgag
gctgaacaagacagctggtaccaggctcttctgcagctgcataatcgggcaaaggcccac
catgacggggctggaggaggctgcggtggtagctgcagcggcagctctggcgtcggagag
gcaggggaggacttgagctatgacacgggcccaggacccgcgttcaaggaggtctggcag
gttatcctgaaacccaagggcttaggtcagacaaagaacttgattggtatctaccgcctc
tgcctgaccagcaagaccatcagctttgtgaagctcaactctgaggctgccgctgtggtg
ctgcagctgatgaacatcagacgctgtggccactcagagaacttcttcttcatcgaggtg
gggcggtcagctgtgaccgggcccggcgagttctggatgcaagtggatgactccgtggtg
gcccagaacatgcatgagaccattctagaggccatgcgggccatgagcgatgagtttcgc
ccgcgcagcaaaagccaatcttcatccagttgctccaaccccatcagtgttcccctgcgc
aggcaccatctcaacaatcctccgcccagccaagtggggctgactcggagatctcgaact
gagagcatcactgccacctcccctgccagtatggtgggtgggaaaccaggttccttcagg
gtgcgtgcctccagcgatggcgaaggcaccatgtcccgtccagcatcagtggatggcagt
cctgtgagccctagcaccaacaggacccacgcccatcggcatcgaggcagctccaggttg
caccccccactcaaccacagccgctccatccctatgccttcttcacgatgctccccttca
gccaccagcccagtgagcctgtcatccagtagtaccagtggccacggctccacttcagac
tgtctcttcccgaggcgctctagtgcttccgtgtccggttctcctagcgatggcggtttc
atctcttctgatgagtatggctctagtccctgcgatttccgaagttccttccgcagtgtc
accccagattccctgggccacaccccaccagccaggggtgaggaggagctgagcaactat
atctgcatgggtggcaagggagcctccaccttgacagctcccaatggtcactacattttg
tctaggggtggcaacggccatcgctacatcccaggtgctaccatggggacaagcccggcg
ctgactggagacgaagccgctggtgcagcagatctggataaccggtttcggaagagaact
cactcggctggcacgtcccccaccatatcccaccagaagaccccctcgcagtcctcagtg
gtttctattgaggaatatacagagatgatgcccgctgcctacccaccaggaggtggcagt
ggaggccgactgcccggctaccggcattccgccttcgtgcccacccactcctatcccgag
gagggtctagagatgcaccacttggaacgtcgtgggggccaccaccgtccagactcctcc
aacctccacaccgatgatggctacatgcccatgtctcccggagtggctccagtgcccagc
aaccgcaaaggaaatggggactatatgcccatgagccccaagagtgtatctgccccccag
cagatcattaaccccatcaggcgccacccacagagagtggaccccaatggctacatgatg
atgtctcccagtggtagttgctctcctgacattggaggtgggtcttgcagcagtagcagc
atcagcgcagccccttctgggagcagctatgggaagccatggacaaacggagtagggggg
caccatacccatgcccttccccatgccaaacctcctgttgagagcggtggtggtaagctc
ttgccttgcactggtgactacatgaacatgtcgccagtgggagattccaacaccagcagc
ccctcagaatgctactatggcccagaagatccccagcacaagcctgtcctctcctactac
tcattaccaaggtcctttaagcacacccagcgccctggggagccagaggagggtgccagg
caccagcatcttcgtctctcttcaagctctggacgccttcgctataccgcaactgccgaa
gattcctcctcttccaccagcagcgacagcctgggtgggggttactgtggggctaggcca
gagtctagcgtcacacatccccaccaccatgccttgcagccccatctgcctcgaaaggta
gacacagctgcacagaccaacagccgcctggctcgacccacaaggctgtccttgggggat
cccaaggcaagcactttaccccgggtacgagagcaacagcagcagcagcaacagcagcag
cagtcttccctgcaccctcccgagcccaaaagcccaggagaatatgtgaatattgaattc
gggagtggccagccaggctatttagctggccctgcaacttcccgtagctccccttcagtt
cgatgtctaccccagctccacccagctcccagagaagagactggctcggaagagtacatg
aacatggacttggggccaggccggagggcaacctggcaggagagtggtggagttgagttg
ggcagagtaggccctgcacctccaggggctgcttccatttgtaggccaacccggtcggtg
ccaaatagccgtggtgattacatgaccatgcagataggttgtcctcgtcaaagctatgtg
gatacctcaccagtggccccagtcagctatgctgacatgcggacaggcattgctgcagag
aaggtgagcctgcccagaaccacaggagctgccccccctccatcctccacagcctctgct
tctgcttctgttacacctcaaggggccgctgagcaggccgctcactcttccttgctggga
ggccctcagggacctgggggcatgagcgcattcaccagggtgaacctaagtcccaaccat
aaccagagtgccaaagtgattcgtgcagacactcaaggctgccggaggaggcacagctcc
gagaccttctcggcgcctacgcgggctggcaacacagtgtcttttggagcaggggctgca
ggagggggcagcggtggtggcagtgaggatgtgaaacgccacagctctgcatcctttgag
aatgtgtggctgagacccggggatctagggggagcatccaaggagtcggctccagggtac
ggggctgccgggggattggagaagagtcttaactatatagacttggatttggtcaaggat
gttaagcagcaccctcaagactgcccctctcaacagcagtccctgccaccccctccccct
caccaacccttaggcagcaatgagggcagctccccaagacgctccagtgaggatttaagc
acctatgccagcatcaacttccagaagcaaccagaggaccgtcaatag

KEGG   Rattus norvegicus (rat): 29376
Entry
29376             CDS       T01003                                 

Gene name
Irs2
Definition
(RefSeq) insulin receptor substrate 2
  KO
K07187  insulin receptor substrate 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04068  FoxO signaling pathway
rno04140  Autophagy - animal
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04910  Insulin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno04935  Growth hormone synthesis, secretion and action
rno05010  Alzheimer disease
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    29376 (Irs2)
   04022 cGMP-PKG signaling pathway
    29376 (Irs2)
   04152 AMPK signaling pathway
    29376 (Irs2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    29376 (Irs2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    29376 (Irs2)
   04923 Regulation of lipolysis in adipocytes
    29376 (Irs2)
   04920 Adipocytokine signaling pathway
    29376 (Irs2)
   04935 Growth hormone synthesis, secretion and action
    29376 (Irs2)
  09149 Aging
   04211 Longevity regulating pathway
    29376 (Irs2)
   04213 Longevity regulating pathway - multiple species
    29376 (Irs2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    29376 (Irs2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29376 (Irs2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    29376 (Irs2)
   04932 Non-alcoholic fatty liver disease
    29376 (Irs2)
   04931 Insulin resistance
    29376 (Irs2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    29376 (Irs2)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   29376 (Irs2)
SSDB
Motif
Pfam: IRS PH MEKK4_N PH_11
Other DBs
NCBI-GeneID: 29376
NCBI-ProteinID: NP_001162104
RGD: 69316
Ensembl: ENSRNOG00000023509
UniProt: F1MAL5
LinkDB
Position
16
AA seq 1327 aa
MASAPLPGPPASAGGDGPNLNNNNNNNNNHSVRKCGYLRKQKHGHKRFFVLRGPGTGGEE
AAAAGGSPPQPPRLEYYESEKKWKSKAGAPKRVIALDCCLNINKRADAKHKYLIALYTKD
EYFAVAAENEQEQEGWYRALTDLVSEGRSGDGGSGTTGGSCSASLPGALGGSAGAAGCDD
NYGLVTPATAVYREVWQVNLKPKGLGQSKNLTGVYRLCLSARTIGFVKLNCEQPSVTLQL
MNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVAQNIHETILEAMKALKELFEFRP
RSKSQSSGSSATHPISVPGARRHHHLVNLPPSQTGLVRRSRTDSLAATPPAAKCTSCRVR
TASEGDGGAAGGAGTAGGRPMSVAGSPLSPGPVRAPLSRSHTLSAGCGGRPSKVALAPAG
GALQHSRSMSMPVAHSPPAATSPGSLSSSSGHGSGSYPLPPGSHPHLPHPLHHPQCQRPS
SGSASASGSPSDPGFMSLDEYGSSPGDLRAFSSHRSNTPESIAETPPARDGSGGELYGYM
SMDRPLSHCGRPYRRVSGDGAQDLDRGLRKRTYSLTTPARQRQVPQPSSASLDEYTLMRA
TFSGSSGRLCPSLPASSPKVAYNPYPEDYGDIEIGSHKSSSSNLGADDGYMPMTPGAALR
SGGPNSCKSDDYMPMSPTSVSAPKQILQPRSAAALPPSGAAVPAPPSGAGRTFPVNGGGY
KASSPAESSPEDSGYMRMWCGSKLSMENPDPKLLPNGDYLNMSPSEAGTAGTPPDFFSAA
LRPGGEALKGVPGHCYSSLPRSYKAPCTCGGGDNDQYVLMSSPVGRILEEERLEPQATPG
AGTFGAAGGSHTQPHHSAVPSSMRPSGIVGRPEGFLGQRCRAVRPTRLSLEGLQTLPSMQ
EYPLPTEPKSPGEYINIDFGEGGTRLSPPAPPLLASAASSSSLLSASSPASSLGSGTPGT
SSDSRQRSPLSDYMNLDFSSPKSPKPSTRSGDTVGSIDGLLSPEASSPYPPLPPRPSASP
SSLQQPLPPAPGDLYRLPPATAATSQGPTAGSSMSSEPGDNGDYTEMAFGVAATPPQPIA
APPKPEGARVTSPTSGLKRLSLMDQVSGVEAFLQVSQPPDPHRGAKVIRADPQGGRRRHS
SETFSSTTTVTPVSPSFAHNSKRHNSASVENVSLRKSSEGNSILGGSDEPSTSPGQAQPS
AGVPPAPQARPWNPGQPGALIGCPGGSSSPMRRETSVGFQNGLNYIAIDVRGEQGSLAQS
QPQHPQPGDKNSWGRTRSLGGLLGTVGGSGTSGVCGGPGTGALPSASTYASIDFLSHHLK
EATVVKE
NT seq 3984 nt   +upstreamnt  +downstreamnt
atggctagcgcgcccctgcctgggccccccgcgtcggcgggcggggacggcccgaacctc
aataacaacaacaacaacaacaacaaccacagcgtgcgcaagtgcggctacctgcgcaag
cagaagcacggccacaagcgcttcttcgtgctgcgcggcccgggcaccggcggcgaggag
gcagccgcggctggggggtcgccgccgcagcctccgcggctggagtactatgagagcgag
aagaagtggaagagcaaggcgggcgcgccgaagcgagtgatcgcgctcgactgctgtctg
aacatcaacaagcgcgcggacgccaagcacaagtacctgatcgccctctacaccaaggac
gagtacttcgccgtagcggcggagaacgagcaggagcaggagggctggtaccgcgcactc
accgacttggtcagcgaaggccgctctggcgatgggggctccggcaccacgggcggctct
tgcagcgcctctctcccgggggccctgggcggctcggcgggcgccgctggctgcgatgac
aactacgggctcgtgacgcccgccacggcagtctaccgcgaggtgtggcaggtgaacctg
aagcctaagggactgggccagagcaagaacctgaccggtgtataccgcctatgcctgtct
gcgcgcaccatcggcttcgtgaagctcaattgcgaacagccgtcggtgacgctgcagctt
atgaacattcgccgctgcggccactcggacagcttcttcttcatcgaggtgggccgttca
gccgtcaccggtcccggcgagctgtggatgcaagccgatgactcggtggtggcgcagaac
atccatgagaccatcctggaggccatgaaggcactcaaggagctcttcgagttccggcct
cgcagcaagagtcagtcgtctgggtcgtctgccacgcaccccatcagcgtaccgggcgcg
cgccgccaccaccacctagtcaacctaccccctagccagacgggcctggtgcgccgctct
cgcactgatagcctggcggccaccccgccagcagccaagtgcacttcgtgccgggttcgt
acagccagcgagggtgacggcggcgcggcaggcggagccgggacggcaggaggcaggccg
atgtcggtggcagggagccccctgagtcccgggccggtgcgcgcgccccttagccgctcg
cacaccctgagcgccggctgcggaggccgcccgagcaaagtggctctggcgccggcaggg
ggagccctacaacacagccgctccatgtccatgcccgtggcgcactcgccgcctgcagcc
accagcccaggcagcctgtcctccagcagtgggcatggctcaggctcctacccgctgcct
cctggttcccacccgcacctgcctcatccgctccatcacccccaatgccaacgtccgtcc
agcggaagtgcctccgcctcgggctcccccagcgacccgggtttcatgtcccttgacgag
tatggctccagccctggtgacctgagagccttcagtagccacaggagcaacacacctgag
tccatcgcggagaccccgccagccagggacggcagtgggggcgagctctatgggtatatg
agcatggataggcccctgagccactgtggccgcccttaccgtagggtctctggggatggg
gcccaggatctggacagaggactgaggaagaggacttactccctaaccacgcctgcccgg
cagcggcaggttcctcagccttcctctgcctctctagacgaatacactctcatgcgggcc
accttctctggcagttcaggtcgcctctgcccatccctccctgcgtcctctcccaaagtg
gcctacaacccttacccagaggactatggagacattgagattggttctcacaagagttcc
agcagtaacctgggggcagatgatggctacatgcccatgacccctggggcagccctcagg
agtggtggccccaatagctgcaagagcgatgactacatgcccatgagccccaccagcgtg
tctgcccctaagcagatcctgcaaccacgttcggcagcggccttgcccccctctggagca
gccgtgccagcacccccttcaggggcgggcaggactttcccagtgaacggaggcggctac
aaagccagctccccagcggagagctccccagaagatagcgggtacatgcgaatgtggtgt
ggctccaagctgtccatggagaacccagaccctaagctgctccccaatggggactacctc
aacatgtcccccagtgaggcaggcaccgcagggaccccacctgacttcttctcagcagct
ttgcgtccaggcggtgaggccctcaaaggcgtccctggccactgctacagctctttgccc
cgctcttacaaggctccctgtacttgcggtggtggagacaacgaccagtacgtgctcatg
agctcccctgtgggtcggattttggaagaggagagactggagccccaggccaccccaggg
gctggcacatttggggcagctggtggtagtcatacccagcctcatcactcagcagtgcct
tcctccatgagaccaagtggcatcgttggccgacctgagggcttcctgggccagcgctgt
cgggcagtgcggcccacacgcctttcgctagagggactgcagacccttcccagcatgcaa
gagtaccctctacccactgagcccaagagccctggcgagtacatcaacattgactttggt
gaagggggtacccgtctgtctccgcctgctcccccactactggcatcagcggcctcctcc
tcttcactgctctcagccagtagtcctgcttcatccctgggttcaggtaccccaggcacc
agcagtgacagccggcagcgctctccgctctctgactatatgaacctggacttcagttct
cccaagtcccctaagcctagcacccgcagtggggacacagtgggctccatcgatggcctt
ctctctccagaagcctcatccccatacccaccgctgcccccgcgtccttctgcttcccct
tcctccttacagcagcctctgccacctgccccaggagacctataccgcctgcctccagca
acagctgccacatcccagggtcccactgctggctcctcaatgtcctctgagcctggggat
aatggtgactataccgagatggcctttggtgtggctgctaccccgccacaacctattgcg
gcacccccgaagccagaaggtgcccgagtgaccagtcccacatcaggcttgaagcggcta
agtctcatggatcaggtatctggggtagaggccttccttcaagtcagccagccccctgat
ccccaccggggcgctaaggtcatccgtgcagacccgcaggggggacgtcgtcgccacagt
tcagagaccttctcctctaccaccactgtcaccccagtgtccccatcctttgctcacaat
tccaagcgccacaattcggcctctgtggaaaacgtctctctcaggaaaagcagtgaaggc
aacagcatcctgggaggaagtgatgagccatccacatccccaggacaggcacagccctcg
gcaggtgtgcccccagcgccacaggctaggccatggaaccccggtcagcctggagctttg
attggctgtcctggaggcagcagttctcccatgcgcagagagacctccgtgggtttccag
aacggcctcaactatatcgccatcgatgtgagaggtgagcaggggtccttggcgcagtct
cagcctcagcatccacagccaggagacaagaactcctggggccggacccgtagccttggg
gggctcctcggtaccgttggaggctctggcaccagtggagtgtgtgggggtccaggcact
ggagccttaccctctgccagcacctacgcaagcatcgacttcttgtcccatcacttgaaa
gaagccaccgtggtgaaagagtaa

KEGG   Rattus norvegicus (rat): 315350
Entry
315350            CDS       T01003                                 

Gene name
Irs4
Definition
(RefSeq) LOW QUALITY PROTEIN: insulin receptor substrate 4
  KO
K17446  insulin receptor substrate 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04068  FoxO signaling pathway
rno04140  Autophagy - animal
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04910  Insulin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04930  Type II diabetes mellitus
rno04935  Growth hormone synthesis, secretion and action
rno05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    315350 (Irs4)
   04022 cGMP-PKG signaling pathway
    315350 (Irs4)
   04152 AMPK signaling pathway
    315350 (Irs4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    315350 (Irs4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    315350 (Irs4)
   04923 Regulation of lipolysis in adipocytes
    315350 (Irs4)
   04920 Adipocytokine signaling pathway
    315350 (Irs4)
   04935 Growth hormone synthesis, secretion and action
    315350 (Irs4)
  09149 Aging
   04211 Longevity regulating pathway
    315350 (Irs4)
   04213 Longevity regulating pathway - multiple species
    315350 (Irs4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    315350 (Irs4)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    315350 (Irs4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    315350 (Irs4)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   315350 (Irs4)
SSDB
Motif
Pfam: IRS PH_11 SUIM_assoc PH_8
Other DBs
NCBI-GeneID: 315350
NCBI-ProteinID: XP_235721
RGD: 1562442
Ensembl: ENSRNOG00000046790
LinkDB
Position
X
AA seq 1230 aa
MASCSFAGDXALRRLRAAAAAASAALAAVATTPLLSSGTPTALIGTGSSCPGAMWLSPAT
GSRSDSESDEEDLPVGDEVCKRGYLRKQKHGQRRYFVLKLETEDAPARLEYYQNARKFRL
SVRAAAAAAAAAASGAAVPALIPPRRVIILYQCFSVSQRADARYRHLIALFTQDEYFAMV
AENESEQESWYLLLSRLILESKRRRCGTLGAQPDGEPAALAAAAAAEPPFYKDVWQVVVK
PRGLGHRKELSGVFRLCLTDEEVVFVRLNTEVASVVVQLLSIRRCGHSEQYFFLEVGRST
VIGPGELWMQVDDSVVAQNMHELFLEKMRALCADEYRARCRSYSISVGAHLLTLLSTRRH
LGSLPLEPGGWFRRSRFEQFCHLRAICHREDMLFTRRFIAPREPPPPFKRGRGHLPRARR
SRRAVSVPPSFPRRSAPSPGRIRQPEDARNHRACQASGSSSGNSEEKDKEGEEGNGGACM
PMNNWGSGNGRGSGGGQGSSGQGSSSQSSGGRQGSGGGQGSGGQGAGGNQRSGNGQGTAG
GHGSGGGGHGSGGGQGPGDGHGSGGGKNSGGSKGSGSGKNSDDGDRGKSVKKRSYFGKFT
QSKQQQQQQQTLPPPPPPPPAAGATGGKGKSGGRFRLYFCADRGTKERKEAKEVRNMETS
QGTTRGSLRARALYEDEDDPYVPMRPGVAAPLACSSDYMPMAPQNSSAPTKRHSKSPFED
SRGYMMMFPRVSPPPPAPSARKAPDTHKEDDSKDNDSDSDYMFMAPGAGAIPKNPPNPQG
GSSSKSWSSYFSLPSPFQSSPLGQSNHSEYVPMLPGKFLGSSLDKHASFSQGTKDVASKP
STEGSFSKPEDKGSSARPSDDVPPMNQAKEPNRLSFIAKGNKIKPRPLNPTQEQREADSS
NDYINIDFVKREHLVLAPSAQGLPEFWGVITNARPSAFSRYVKVEFGAPFPNPTVRLSEL
LRVIPGANPIPLAGARWPFRPFPGNAVGSILEGGEYIEVIFNPALTPAVPFADSAICYDT
QTGQIYVVDPFSECCMDASVSPSRYSEPPPVARQEEVQERRRPQSGSQSLFANTRAAVSA
FPTDSLDRDFPAASAVIAAPAGAPLLAVSRALAVASALAAAPSTGAVFVGFPVAAGDSAS
ARWFQPVANAPGAQAEREVRDIAAGWNPGTLNQAANGEDLAAGAAAPPPPPRHHRVLRPP
ERADSEDNYDDEDDDNIYVRMDFARRDYKK
NT seq 3693 nt   +upstreamnt  +downstreamnt
atggcgagttgctccttcgctggcgactaagcgctaaggagactgagagccgcagcagca
gcagcctccgcagctctagcagcagtggcgaccaccccgcttctttcctcgggaaccccg
accgcactcattgggaccgggtcgtcctgtccgggagccatgtggctctccccagccact
ggctcccggtcagactccgagtccgacgaggaggacctccccgtcggggatgaagtctgc
aaacgcggctacctgcggaagcagaagcatgggcagaggcgttacttcgtgctcaaactc
gagaccgaagacgctccggctcggctcgaatactaccaaaatgccaggaagttccggctc
agtgtccgtgccgcggcggctgccgcagccgcggccgcctccggtgctgcggtccccgcg
ctcatcccaccgcggcgcgtgatcatcctgtaccaatgcttctccgtgagccagcgcgcc
gatgccaggtaccgacacctcattgccctctttacccaggacgagtacttcgcgatggtg
gccgagaatgagtcggaacaagaaagctggtacttgctcctcagccgcctcatcctcgag
agcaagcgccgccgctgcggcacgctaggcgcgcagccggacggggagccggcagccctg
gcggcggcagcggcggcggagccacccttctacaaagatgtgtggcaggtagtagtgaaa
cccagggggctggggcacagaaaagagctgagcggcgtgttccggctgtgtcttaccgac
gaagaggtagtgtttgtaaggctcaataccgaagtggccagcgtggtcgtccagctgctg
agcattcgtcgctgtgggcactcagagcagtacttcttcttggaagtcggcaggtccact
gtcatcggtccaggggagctgtggatgcaggtggatgactccgtggtggcccaaaacatg
catgagttgtttctggagaagatgagagccttgtgcgcagacgaatacagagcccgctgc
cgcagctacagcatcagtgttggcgcccacctgttaaccctgctgtccactaggaggcac
ctgggctcgctcccgctggagcccggcggctggttcagaagatcccgctttgagcagttt
tgccacctcagggctatctgccacagggaagacatgctattcaccagacgcttcatcgca
cccagagagcctccgcctcccttcaagcgaggaagggggcacctgcccagagcccgcagg
tccaggagagccgtgtcagtacctcccagctttccccgacgctcagcacctagcccagga
cgtatccgacagcctgaagatgctcgcaaccaccgagcttgtcaagcctcgggttccagc
tctggcaactctgaagaaaaagacaaggaaggtgaggaaggaaacggaggtgcctgcatg
cctatgaacaactggggctcaggaaatggccggggctccggaggtggacagggctcaagt
ggccaaggctccagtagccagagctcaggtgggagacagggatctggaggtggccagggc
tcaggaggccagggtgctggaggaaaccagcgttcaggaaatggccagggcacagcaggt
ggccatggctcaggtggaggtggccatggttcaggtggtggccagggacccggagatggt
catggctcaggtggtggcaagaactcaggaggtagcaaaggctcaggaagtgggaaaaat
tctgacgatggtgaccgtggaaaatctgtgaagaaaagatcctactttggtaaattcact
caaagcaagcagcagcagcagcagcagcaaacgctgcctccacccccaccgccgccgcca
gcagctggagcaactggtggcaaagggaagtctggggggagattccgactttatttttgc
gcagacagaggcacaaaagaacgcaaagaagccaaagaggtgagaaatatggagacctca
caaggtacaacccgggggtctctcagagccagagctctctatgaagatgaggatgaccca
tatgtgccaatgaggccaggggtggctgctcctcttgcatgttccagcgattacatgcca
atggctcctcaaaattcctctgctccaaccaagcgtcactctaagtcgccctttgaagac
tccagagggtacatgatgatgtttcccagagtgagcccaccaccacctgctccaagtgct
cggaaagcgccggatactcataaagaggatgactcaaaggacaatgacagtgacagtgac
tacatgtttatggctcctggagcaggtgcgattcctaaaaatccccccaatccccaggga
ggctcttcctccaaaagctggagctcttacttctctctgccaagtcctttccagagttcg
cctttgggacagagtaaccatagcgagtatgttcccatgttacctggaaaattcctgggg
agcagtctagacaaacacgcctcctttagccagggcaccaaagatgtagcttcaaagcct
tcaactgaggggtcattctcaaaacctgaagataaggggtcgtctgcaaggccttcagat
gatgtgcccccaatgaaccaggctaaggaacctaaccgactttcttttattgcaaaagga
aataaaataaagcccagaccactaaaccccacacaggagcagagagaagctgacagctcc
aatgactatatcaacattgactttgttaagagagagcaccttgtgctagctccctctgct
caaggactgccagaattctggggtgtaattactaatgccagacccagcgctttttctcgc
tacgtgaaggttgaattcggggcgccctttccaaatccaacagtccgcctctcagagctt
ttaagagttataccaggtgccaatcccatccctctggccggtgctaggtggccctttcgt
cctttcccaggcaatgctgtaggtagcatcctggaagggggtgaatacattgaagtgatt
ttcaatccagctctgacaccagccgtgccttttgctgacagtgccatttgctatgacact
cagacaggtcaaatttatgtagtcgacccattttctgagtgctgtatggacgcttctgtc
tctcccagtcgatactccgaaccaccacctgtagctaggcaggaagaagtgcaagagaga
agacgcccacaaagcggctcccaaagtttatttgccaacactcgagccgctgtctcggct
ttccctactgacagcttggacagagactttcccgccgcttcagccgtgattgctgctcca
gctggagcgcccctcttggcagtgagccgggctttagcagtggcctctgcgctcgcagcg
gcccccagcactggcgctgtctttgtcggcttcccagttgcggctggagactccgcctcc
gctcgctggttccaacctgttgctaatgctcctggtgcccaggccgaaagagaggtccgg
gacattgccgcaggctggaatcctggaacccttaaccaagctgccaacggtgaggacctg
gcggctggcgcagccgctcccccgccgccgcctcgccaccatcgggtgctgagaccccca
gagagagcggattctgaggacaactatgacgatgaggatgacgacaacatttacgtgaga
atggactttgccagacgtgactacaagaagtga

KEGG   Rattus norvegicus (rat): 84021
Entry
84021             CDS       T01003                                 

Gene name
Irs3
Definition
(RefSeq) insulin receptor substrate 3
  KO
K17445  insulin receptor substrate 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04068  FoxO signaling pathway
rno04140  Autophagy - animal
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04910  Insulin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04930  Type II diabetes mellitus
rno04935  Growth hormone synthesis, secretion and action
rno05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    84021 (Irs3)
   04022 cGMP-PKG signaling pathway
    84021 (Irs3)
   04152 AMPK signaling pathway
    84021 (Irs3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    84021 (Irs3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    84021 (Irs3)
   04923 Regulation of lipolysis in adipocytes
    84021 (Irs3)
   04920 Adipocytokine signaling pathway
    84021 (Irs3)
   04935 Growth hormone synthesis, secretion and action
    84021 (Irs3)
  09149 Aging
   04211 Longevity regulating pathway
    84021 (Irs3)
   04213 Longevity regulating pathway - multiple species
    84021 (Irs3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    84021 (Irs3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    84021 (Irs3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    84021 (Irs3)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   84021 (Irs3)
SSDB
Motif
Pfam: IRS PH PH_11
Other DBs
NCBI-GeneID: 84021
NCBI-ProteinID: NP_114463
RGD: 69317
Ensembl: ENSRNOG00000001389
UniProt: O08724
LinkDB
Position
12
AA seq 494 aa
MKPAGTGPTVSSGGESTDVSLGPPFPWPCPPDVRLCGHLRKQKSQRRRFFVLRADPPRLE
CYESEKKFLASGCRPPRPRRTVSLEGACTISKRADARQRHLIVIYTSDSSLGVAAASEAE
QQTWYSALLEVRATAAAAAATAMGFSPQEAPESWIFAPFQDVWPVTLRSKGLGRAPGLSS
GSYRLCLGSGALSLLRKPGSKGSRDSRATPPPVLRLSLLSVRRCGHADSFFFLELGRSAP
IGPGELWLQAPDAVVAQSIHETVLAAMKRLGSSAASGKAEAPLGDSPKGASAVPAPAPYE
IPALALAAQARSPGERAKQDYVNPLERMGSAPSYRGPDLGGDYIAMGMRNDYVHMGGKAA
EYMWMAPPGLPPPTPPRVDPRKEPEDCESTEYMPMNRFLPGPLYYEFKAREPEHGHSSAQ
CSIRDRWRPMVAQPRSSQGSELSGDYMYIPDYPSARLGSLDSCLNYVDLDLVPPLEVPGA
APGNSPHSYASIKF
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgaagcctgcaggtacgggccccacagtctcctctgggggcgagtccaccgacgtgtcc
ctcggcccgccgtttccttggccctgcccgcccgacgtgcggctctgtggccatctgagg
aagcagaagtcccagcgccgccgctttttcgtgctgcgtgctgacccaccacggctggag
tgctatgagagcgagaagaagttcttggccagcggctgccgcccacctcgaccccggcgt
accgttagcctggaaggtgcctgcactattagcaagcgcgcggatgcccgtcagcgccac
ctgatcgtcatctataccagcgacagcagcctgggcgtggcggcggccagtgaagcagag
cagcaaacatggtacagcgccttgctcgaggtgcgcgccaccgccgctgcagctgctgcc
accgctatgggtttcagcccccaagaggcccctgagtcttggatcttcgccccgttccag
gacgtctggcctgtgacactgcggtccaaggggctggggagagcaccaggcctgagcagc
ggcagctatcgcctgtgcctgggttctggggccctgagcctcctgcggaagccgggaagc
aaaggctccagagacagccgggcaacgccaccaccagtcctgcgcttgtccttgcttagt
gtgcgccgctgcggccacgcagattcctttttcttcctggaactcgggcgctcagcgccc
ataggtcctggtgagctgtggctgcaggcccctgatgcagtggtggcccaaagcattcat
gagaccgtcctggctgccatgaagagactggggagcagtgcagccagtggcaaagctgag
gcaccgctgggagattctccaaagggggcttctgcagtccctgccccagcaccatatgag
atccctgctttggcactggcagcacaagcgagaagtccgggtgagagagcgaagcaggac
tacgtcaatccactggaaaggatggggtcagcaccctcctacagggggccagatctgggt
ggggactacatcgccatgggaatgaggaatgactatgtgcacatgggggggaaagctgct
gagtacatgtggatggcgcccccaggtctccctccccccacccctcccagggtagatccc
agaaaggagcctgaggattgtgagagcacagagtatatgcccatgaacagatttttaccg
gggcctctttactacgagttcaaggccagggagcctgaacatgggcattctagtgcccag
tgtagcattagggacagatggagacccatggtggctcagccccgctcttcccaagggtca
gagctctctggggactacatgtacatccctgactatcccagtgctaggctggggtctctg
gacagctgcctcaactatgtggacctggacctagtccctcccctggaggttcctggagcg
gccccagggaatagtccacatagctatgccagcatcaagttctag

DBGET integrated database retrieval system