KEGG   Rattus norvegicus (rat): 287796
Entry
287796            CDS       T01003                                 
Symbol
Slc39a11
Name
(RefSeq) zinc transporter ZIP11
  KO
K14717  solute carrier family 39 (zinc transporter), member 11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05010  Alzheimer disease
rno05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    287796 (Slc39a11)
   05012 Parkinson disease
    287796 (Slc39a11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    287796 (Slc39a11)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   287796 (Slc39a11)
SSDB
Motif
Pfam: Zip
Other DBs
NCBI-GeneID: 287796
NCBI-ProteinID: NP_001013060
RGD: 1311981
Ensembl: ENSRNOG00000031213
UniProt: Q6P6S2
LinkDB
Position
10:complement(98275958..98697042)
AA seq 335 aa
MLQGYSSVSQALLGTFFTWAMTAAGAALVFIFSSGQRRILDGSLGFAAGVMLAASYWSLL
APAVEMATSSGGFGAFAFFPVAVGFTLGAAFVYLADLLMPHLGAGEDPQTALALNLDPAL
VKKSDLKDPASLLFPERELSIRIDKRENGEVYQRKKLAATDFPEGAAPSGPVHGNSGQPG
VSSWRRIALLILAITIHNIPEGLAVGVGFGAVEKTASATFESARNLAIGIGIQNFPEGLA
VSLPLRGAGFSTWKAFWYGQLSGMVEPLAGVFGAFAVVLAEPVLPYALAFAAGAMVYVVM
DDIIPEAQISGNGKLASWASILGFVVMMSLDVGLG
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgcttcaaggttacagctctgtttcccaggccttgctggggaccttcttcacctgggca
atgacagcggcgggagcggctctcgtgttcatattctccagtgggcagaggcggatctta
gatggaagcctgggttttgctgcaggggtcatgttagcagcttcctattggtcgctgctt
gcaccagcggttgagatggccacctcctcagggggctttggtgccttcgccttcttccca
gtggccgtaggcttcaccctgggagctgcttttgtctacctggctgacctcctgatgccc
cacctgggtgctggagaagacccccagacggccctggcgctgaacttggaccctgcattg
gtgaagaagtctgatctcaaggaccccgcctcactgctcttccccgagagggaactttcc
atccggatagacaagcgtgagaatggcgaggtgtaccagaggaagaagctggcagctacc
gacttcccagagggcgcggccccctcaggacctgtgcacgggaactcagggcaacccggg
gtgagcagctggaggagaattgctctgctcatcctggccatcaccatacacaacattcca
gagggtctcgctgtcggtgtagggtttggagcagtagaaaagactgcatctgccaccttc
gagagtgccaggaatctggccattggaattgggattcaaaatttcccagagggcctggct
gtcagccttcctctgcgtggagcaggcttctctacctggaaagctttctggtatggacag
ctgagcggcatggtggagcccttggctggggtctttggagcctttgcggtggtgctggct
gagcccgtcttgccctacgcgctggcctttgccgccggtgccatggtctacgtggtcatg
gacgacatcatccccgaagcccagatcagtggcaacgggaaactggcatcctgggcctcc
atcctgggatttgtggtgatgatgtcccttgacgtgggcctcggctag

KEGG   Rattus norvegicus (rat): 291328
Entry
291328            CDS       T01003                                 
Symbol
Slc39a12
Name
(RefSeq) zinc transporter ZIP12
  KO
K14718  solute carrier family 39 (zinc transporter), member 12
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05010  Alzheimer disease
rno05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    291328 (Slc39a12)
   05012 Parkinson disease
    291328 (Slc39a12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    291328 (Slc39a12)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   291328 (Slc39a12)
SSDB
Motif
Pfam: Zip ZIP4_domain
Other DBs
NCBI-GeneID: 291328
NCBI-ProteinID: NP_001099594
RGD: 1309305
Ensembl: ENSRNOG00000025639
LinkDB
Position
17:77353761..77440381
AA seq 555 aa
MSNREYEFYLHSLLSLRQDEDSYFLSEKETDDILASTRKYFGTSTSPCMETKILQRESGI
QSSNGADEKMLPQLAATIIALSLQGVCLGRKDSPSPDDFTEYIFSFLNRTNALHLSELEE
LLNMLSTRRACTKINTLHEHQRKQNTAVHGLRDPKSAAAMDKVSGDHSVSWDQACFSAQQ
LVEIFLQNHSSLSISKEDFKQLSPGIIQQLLSCSCQVPRDQKAKPPPTTLEKYGYSTVAV
TLLTLGSMLGTALVLFHSCEENYSLILQLFVGLAVGTLSGDALLHLIPQVLGLHKQEAEL
GHFHESQSPIWKLLGLLGGIHGFFLIEKCFILLVSPNTKGLPLVNGHAGHTHHLGLSPEL
NDQSGGGKSISTIQLKGPEDSQTAELPKGNVPASNRNRKTISLLAVMVLVGDGLHNFADG
LVIGTAFSSSLESGVTTTIAILCHEIPHEMGDFAVLLSSGLSIRTAILMNFLSALTAFIG
LYIGLSVSADPRVQDWILTVTAGMFLYLSLVGMLPEMTHVQTQRPWMTFLLQNVGLVLGW
FSLLLLAVYEQNIKI
NT seq 1668 nt   +upstreamnt  +downstreamnt
atgagcaacagagaatatgagttctacctgcacagccttctcagcctcaggcaggatgaa
gactcctatttcctctcagagaaggagactgatgacatcttggcttccaccaggaagtac
tttggcacctccactagtccgtgtatggaaactaagattctacagagggaatctggcatt
cagagcagcaatggtgctgatgaaaagatgcttcctcagctggctgccaccatcattgct
ctgtcgctccaaggagtttgtttggggagaaaagactcgccttccccagatgactttaca
gaatatattttcagtttcctgaatagaaccaatgccctccacctctctgaactagaggaa
cttctgaacatgctctcgaccagaagggcctgtaccaaaataaataccctccatgaacac
caaaggaaacaaaacacagcagtacatggtttgagagaccccaagtcagctgcagcaatg
gacaaagtgtctggtgatcattctgtttcctgggatcaggcttgcttctctgctcagcag
ctggtggagatatttcttcagaaccacagcagtctgtccatttcgaaggaggactttaag
cagctaagtccagggatcatccagcaactcctcagctgctcttgtcaggtgcccagggac
cagaaagcaaagcccccacccaccactctggagaaatatggttatagcacggtggcagtg
acactactaaccttgggctccatgcttgggaccgcgctggtccttttccacagctgcgag
gagaattacagtctgattttacagttattcgtgggcttggccgtggggacactctccggg
gatgccctgctccatctcattcctcaggttcttggtttacataagcaggaagcagagctt
gggcatttccacgaaagccaaagtcctatttggaagctgttgggactacttggaggcatc
catggatttttcttgatagaaaaatgttttatccttcttgtatcgccaaataccaagggc
ctgccattagttaatggacatgcaggacatacccaccatcttggactcagtcctgagtta
aatgaccagtcaggtggaggcaagtctatatcaaccattcagctgaaaggcccagaagat
tcacagacagctgagctacccaaaggcaatgtgccagcctccaacagaaaccgcaaaacc
atcagcttgttggctgttatggtcctggttggagatggcctgcacaattttgccgatggc
ctagtaataggcacagccttctcttcttcattggagtcaggagtgaccacaacaatcgct
attttgtgtcatgaaattccacatgaaatgggagactttgctgtgctcttaagctctgga
ctctccatcaggactgccatcctaatgaatttcctaagtgccctgacagccttcatagga
ctgtacattggtctctcggtgtctgctgatccacgtgtccaagactggattttaacagtg
actgctgggatgttcttgtatttatccttggtggggatgcttcctgaaatgactcatgtg
cagacacaacgaccctggatgacgtttctcctgcagaatgttggattggtccttggctgg
ttttcacttttgctcttagctgtatatgaacagaatattaaaatataa

KEGG   Rattus norvegicus (rat): 291733
Entry
291733            CDS       T01003                                 
Symbol
Slc39a6
Name
(RefSeq) zinc transporter ZIP6 precursor
  KO
K14712  solute carrier family 39 (zinc transporter), member 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05010  Alzheimer disease
rno05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    291733 (Slc39a6)
   05012 Parkinson disease
    291733 (Slc39a6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    291733 (Slc39a6)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   291733 (Slc39a6)
SSDB
Motif
Pfam: Zip
Other DBs
NCBI-GeneID: 291733
NCBI-ProteinID: NP_001019916
RGD: 1304664
Ensembl: ENSRNOG00000028703
UniProt: Q4V887
LinkDB
Position
18:complement(15864874..15885417)
AA seq 741 aa
MATNLSVIMILTFALWVTNPLHELQSTAAFSQTTEKINSNWESGINVDVAVTMQRHHLQQ
LFYRYGENDSLSVEGFRKLLQNIGIDKIKRVHIHHDHERHSDHERHSDHERHSHRGHAAA
GKNSRKAFCPDLDSDNSGKNPNTSQGKGSRPAEHVNGRRNGKESASSSEVTSAVYNTVSE
GTHFLETIETPKPGRRTKDINPSTPPSITEKSRVGRLSRLARRKGNDSVSEPRKSFMYSR
TSNDNIQECFNATKLLTSHGMSVQALLNATEFNYLCPAIINQIDARSCLIHTASEKKAEI
PPKTYSLQIAWLGGFIAISIISFLSLLGVILVPLMNRVFFKFLLSFLVALAVGTLSGDAL
LHLLPHSHASHHHSHSHEEPAMEMKRGPLFSHLSAQNLEESSYFDSTWKGLTALGGLYFM
FLVEHVLTLIKQFKDKKKKNQKKPENDEDVESKKQLSKYESQLSTNEEKVDTGERPESYL
QADSQEPSPFDSQQPTLLEEEEVMIAHAHPQEVYNEYVPRGCKNKCHSHFHDTLGQSDDL
IHHHHDYHHILHHHHHQNHHPHSHSQRYSREELKDAGIATLAWMVIMGDGLHNFSDGLAI
GAAFTEGLSSGLSTSVAVFCHELPHELGDFAVLLKAGMTVKQAVLYNALSAMLAYLGMAT
GIFIGHYAENVSMWIFALTAGLFMYVALVDMVPEMLHNDASDHGCSRWGYFFLQNAGILL
GFGIMLLISIFEHKIVFRINF
NT seq 2226 nt   +upstreamnt  +downstreamnt
atggccacaaatttatctgtaatcatgatcttgacctttgccctttgggttacaaatccc
cttcatgaactacaatcaacagctgctttctctcagaccactgagaaaattaattcaaat
tgggaatctggcattaatgttgacgtggcagttaccatgcagcgacatcatctgcaacag
cttttctaccgctatggagagaatgactccttgtcagttgaaggcttcagaaaattactt
cagaacataggcatagataagattaaaagagtccacatacaccatgaccacgagcgccac
tctgaccacgagcgccactctgaccacgagcgccactcccaccgaggtcatgctgccgct
gggaaaaacagtcggaaagccttttgcccagaccttgactctgataattcaggtaaaaat
ccgaacaccagccaaggtaaaggatctcgcccagcagagcatgtgaatggcaggaggaat
ggcaaggagagtgcaagctctagtgaagtgacctcggcagtttacaacactgtctctgaa
ggaactcactttctagagacaatagagactccaaaacccgggagacgcaccaaagatata
aacccttctaccccacccagcatcacagagaagagccgagtgggccggctgagccgacta
gctaggaggaaaggcaacgattctgtgagtgagcccaggaagagcttcatgtattccaga
acctcaaatgacaatatccaggagtgcttcaatgcaacaaaactgctgacatcccatggc
atgagcgtccaggctctgttgaatgcaacagagtttaactatctctgtccagccattatc
aatcaaattgatgctcggtcttgtctgattcacacagcaagtgagaagaaggcggaaatc
cctccaaagacctattctttacaaatagcctggctcggtggcttcatagccatttccatc
atcagtttcctgtctctgctgggagtcatcttggtgccactcatgaaccgagtgttcttc
aagttcctgctgagcttcctcgtggcgctggccgtggggactctgagtggcgacgctctg
ttacatcttctcccacattctcatgcaagtcatcaccacagtcatagccatgaagaacca
gcaatggaaatgaaaagaggtcccctgttcagccacctgtcggctcagaacctagaagaa
agctcctattttgattccacgtggaaaggtctgacggctctagggggcttatatttcatg
tttcttgtggaacacgtcctcacgctgatcaagcaatttaaagataagaagaagaagaat
cagaagaaacctgaaaatgatgaggatgtggagagcaagaagcagctgtccaaatacgaa
tctcagctttccacaaacgaagagaaggtggacacaggtgaacgacctgaaagctatctg
caagcggactcccaagagccctccccctttgattcccagcagcccacgctgttggaagag
gaagaggtcatgatagcccacgcacacccacaagaagtctacaacgaatacgtgcccagg
ggctgcaagaacaagtgccactcacacttccacgacacgctgggccagtctgacgacctc
attcaccaccaccacgactaccaccacattctgcaccaccaccaccaccagaaccaccac
ccccacagccacagccagcgctactctcgggaggagctgaaggatgctggcattgccacg
ttggcctggatggtgatcatgggcgatgggctgcacaatttcagcgacggccttgccatc
ggtgctgctttcactgagggtttgtccagcgggctaagcacctctgtcgctgtgttctgt
catgagctgcctcatgaactcggtgactttgctgttttgctaaaggctggcatgaccgtc
aagcaggcagtgctctacaatgccctgtcagccatgctggcctatcttggaatggcaaca
gggatattcatcgggcattatgcagaaaatgtttccatgtggatatttgccctcactgct
ggcttgttcatgtatgtcgctctggtcgacatggtacccgagatgctgcacaatgatgcc
agtgatcacggatgcagccgctggggatatttcttcctgcagaatgctgggatacttctg
ggttttggaattatgttactcatttccatatttgagcataaaattgtgtttcgtataaat
ttctaa

KEGG   Rattus norvegicus (rat): 294281
Entry
294281            CDS       T01003                                 
Symbol
Slc39a7
Name
(RefSeq) zinc transporter SLC39A7 precursor
  KO
K14713  solute carrier family 39 (zinc transporter), member 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05010  Alzheimer disease
rno05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    294281 (Slc39a7)
   05012 Parkinson disease
    294281 (Slc39a7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    294281 (Slc39a7)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   294281 (Slc39a7)
SSDB
Motif
Pfam: Zip
Other DBs
NCBI-GeneID: 294281
NCBI-ProteinID: NP_001008885
RGD: 1593280
Ensembl: ENSRNOG00000000465
Vega: OTTRNOG00000001661
UniProt: Q6MGB4
LinkDB
Position
20:4823166..4826538
AA seq 468 aa
MARVLRDPHWVAVGLLTWAALGLLVAGHEGHGDLHRDVEEDFHGHSHGHSHEDFHHGHSH
GHGHTHESIWHGHAHSHDHGHSREDVHHGHSHGHSHDSLHHRGHGHSHGASREAGAPGIK
HHLDTVTLWAYALGATVLISAAPFFVLFLIPVESNSPRHRSLLQILLSFASGGLLGDAFL
HLIPHALEPHSHDTPAQPGHGHSHSGQGPILSVGLWVLSGIVAFLVVEKFVRHVKGGHGH
AHAHGHGHSHGDSHAHGHSHAHGDRHECPSKGKPSSEDEKEAGGLRKRRGGDTGPRDGPL
KPQNPEEEKTGSDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGILTTMTVLLHEVP
HEVGDFAILVQSGCSKKQAMRLQLLTAIGALAGTACALLTEGGAVGSEVAGGAGPGWVLP
FTAGGFIYVATVSVLPELLREASPLQSLLEVLGLLGGVAMMVLIAHLE
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggccagggtcctgcgggacccccactgggtggctgtgggactgctgacctgggcagct
ttggggctgctggtagccggacacgagggtcatggtgacctgcacagagacgtggaagag
gacttccatggccacagccacggacactcacatgaagatttccaccatggccacagccat
ggccatggccacactcatgagagcatctggcatgggcatgcccacagccacgaccatgga
cattcacgggaggatgtgcaccatggccatagccatggccactcccacgatagcctccac
cacagaggacatggacatagccatggagcctctagggaggctggggctccaggcatcaag
caccacctggacactgtcaccctctgggcctatgcactgggggccacagtgctaatctcc
gcggctcccttcttcgtgctcttcctcatccctgtggagtcaaactctcccaggcatcgt
tctctgctccagatcctgctcagttttgcttctggggggctcctgggagatgccttcctc
cacctcatccctcacgccttggaacctcattcgcacgatactccggcacagcctggccac
ggacactcccacagcggccagggccccattctctctgtggggctgtgggttctcagtggg
attgtcgcctttcttgtggtggagaagtttgtgagacacgtgaaaggagggcacggacac
gcgcacgcgcacggacacggacactcgcacggagacagccacgcgcacggacacagccac
gcacacggggataggcatgagtgtccttcaaagggaaagcccagttcagaggatgaaaag
gaagcagggggcttgcggaaaaggagaggaggagacacggggcccagagatggccctctg
aaacctcagaaccctgaagaagaaaaaacaggctcagacctgcgtgtgtctgggtacctg
aatctggctgctgacttggcacacaacttcacagacgggctggccattggtgcttccttc
cgtgggggccgagggcttgggatcctgaccacgatgacagtcctgctgcatgaagtgcct
catgaggttggggactttgccatcttggtccagtctggctgcagcaagaaacaggcgatg
cgtctgcaactcttgactgcaattggagcattggcaggcacagcctgtgcccttctcact
gagggaggggcagtgggcagtgaggtggctggtggtgcaggtcccggctgggttctgcca
ttcactgcaggtggattcatctatgtggcaacagtgtccgtgctacctgagctactgaga
gaggcatccccgttacagtctctcttggaggtgctggggctgctggggggcgttgccatg
atggtactgattgcccatcttgagtga

KEGG   Rattus norvegicus (rat): 295455
Entry
295455            CDS       T01003                                 
Symbol
Slc39a8
Name
(RefSeq) metal cation symporter ZIP8 precursor
  KO
K14714  solute carrier family 39 (zinc transporter), member 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04216  Ferroptosis
rno05010  Alzheimer disease
rno05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    295455 (Slc39a8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    295455 (Slc39a8)
   05012 Parkinson disease
    295455 (Slc39a8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    295455 (Slc39a8)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   295455 (Slc39a8)
SSDB
Motif
Pfam: Zip DUF4271
Other DBs
NCBI-GeneID: 295455
NCBI-ProteinID: NP_001011952
RGD: 1308236
Ensembl: ENSRNOG00000012508
UniProt: Q5FVQ0
LinkDB
Position
2:224171787..224319326
AA seq 462 aa
MAPGRAVAGLLLLAATGLGRPSEGPELAFTEDVLRVFGANQSLSAAQLGRLLERLGAAPQ
QGALELGQLHFNQCLSAEDIFSLHGFSNVTQITSSNFTAICPAILQQLNFHPCEDPQKHS
VKPSFSEVWGYGFLSVTIINLASLLGLILTPLIKKSYFPKILTYFVGLAIGTLFSNAIFQ
LIPEAFGFNPKIDNYVEKAVAVFGGFYMLFFVERTLKMLLKTYGQNDHTHFRNDDFGSKE
KAHQPKTLPLPPVNGVTCYANPAVTEPNGHIHFDTVSVVSLQDGKAESSSCTCLKGPKLS
EIGTIAWMITLCDALHNFIDGLAIGASYTLSLLQGLSTSIAILCEEFPHELGDFVILLNA
GMSTRQALLFNFLSACSCYVGLAFGILVGNNFAPNIIFALAGGMFLYISLADMFPEMNDM
LREKVTGRQTDFTFFMIQNAGMLTGFTAILLITLYAGDIELQ
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggctccgggccgggcagtggccgggctgctgctactggcggccaccggcctgggacgc
ccctcggaggggccggagctcgccttcactgaggatgtgctgagagtgttcggcgccaac
cagagcctgtcggccgcgcagctggggcgcctgctggagcgcctgggggctgcaccccag
cagggagcgctggagctgggccagctccacttcaaccagtgtctgtcagcggaagacatc
ttttctcttcatggtttctcaaacgtcacccagataaccagctcgaacttcactgccatc
tgccctgcgatcttacagcagctgaactttcatccctgtgaggatccacagaagcacagc
gtaaagcccagtttttccgaagtctggggctatggattcttgtcagtgacaatcatcaat
ttggcctctctcctgggattgattttaacccccttgataaagaagtcgtatttccccaag
attttgacttattttgtggggctggctattgggacccttttctcaaatgccattttccag
cttattccagaggcatttggatttaatcccaaaattgacaattatgttgaaaaggcagtt
gctgtgtttggtggattttacatgcttttctttgttgaaagaacacttaagatgctactg
aaaacgtacggccagaatgaccatactcacttcaggaatgatgacttcggttctaaagaa
aaagcccatcaacccaaaacgttgccattacctcctgtcaatggagtgacatgctatgcc
aaccccgctgtcactgagcctaatggacacatccacttcgacactgtcagtgttgtgtcc
ctgcaggatggaaaagcagagtcaagttcatgcacctgtttgaaggggcccaaactgtca
gaaataggaacgattgcttggatgatcacgctctgtgatgcccttcacaatttcattgat
ggcttggcgatcggggcatcctatactctgtctcttcttcaaggactcagtacttccata
gcgatcctgtgtgaggagtttcctcatgagttaggggactttgtgatcttgctcaatgca
gggatgagcactcggcaagccttgctgtttaacttcctctctgcatgttcctgctacgtt
gggcttgctttcggcattttggtgggcaacaactttgctccaaatattatatttgcactt
gctggaggcatgttcctttacatttctctggcagatatgtttccagagatgaacgacatg
ctgagagaaaaagtaactggaagacaaacggacttcaccttcttcatgatccagaacgca
gggatgttaaccggattcactgccatcttgctcatcaccttgtacgcaggggacatcgaa
ttgcagtag

KEGG   Rattus norvegicus (rat): 295928
Entry
295928            CDS       T01003                                 
Symbol
Slc39a13
Name
(RefSeq) zinc transporter ZIP13 precursor
  KO
K14719  solute carrier family 39 (zinc transporter), member 13
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05010  Alzheimer disease
rno05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    295928 (Slc39a13)
   05012 Parkinson disease
    295928 (Slc39a13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    295928 (Slc39a13)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   295928 (Slc39a13)
SSDB
Motif
Pfam: Zip
Other DBs
NCBI-GeneID: 295928
NCBI-ProteinID: NP_001034285
RGD: 1304695
Ensembl: ENSRNOG00000011981
UniProt: Q2M1K6
LinkDB
Position
3:complement(77039411..77047536)
AA seq 361 aa
MPGCPCPGCGMAGQRLLFLTVLALELLERAGGSQPALRSLGAAAACRLDSKESESWGALL
SGERLDTWICSLLGSLMVGLSGVFPLLVIPLEMGTMLQSEAGAWRLKQLLSFALGGLLGN
VFLHLLPEAWAYTCNISPGVEGQSLQRQQQLGLWVIAGFLTFLALEKMFLNCKEEDPSQA
PSKDPTAAALNGGHCLAQPAAEPGLRAVVRNLKVSGYLNLLANTIDNFTHGLAVAASFLV
SKKIGLLTTMAILLHEIPHEVGDFAILLRAGFDRWTAAKLQFSTALGGLLGACFAICTQS
PKGVEETVVWTLPFTSGGFLYVALVNVLPDLLEEDDPWHLNPPLPTGTPCSRCCCSAPVS
W
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgcctggatgtccctgccctggctgtggtatggcaggccagaggctcctcttcctcact
gtccttgccctggagctcctggaaagggctggaggttcccagccagccctccggagcctg
ggggctgcagctgcctgtcgcctggatagtaaagaaagcgagtcctggggggctctgctg
agtggggagcgactggacacctggatctgctccctcttgggctctctcatggttgggctc
agtggggttttccccttgctggtcattcccctggagatggggaccatgttacaatcagaa
gctggagcctggcgcctgaagcagctgctcagctttgccttaggtggactcctgggcaat
gtgtttctgcacttgctgccagaggcgtgggcctacacctgtaacatcagccccggtgtt
gaagggcagagtctgcagcgacagcaacaactggggctgtgggtcatcgctggcttcctg
accttcctggcattggagaagatgttcctcaactgcaaggaggaggaccctagccaggcc
cccagcaaagaccccactgctgccgcgctcaatggaggccactgtctggcccagccggct
gcagagcccggcctgagagccgtggtccggaacctcaaagtcagtggctatctcaacctg
ctggccaataccattgacaacttcacccatgggctggctgtggctgccagcttccttgtg
agcaaaaagattgggcttctaaccaccatggccatcctcctgcatgagatcccccatgag
gtgggtgactttgctatcctgctccgggctggctttgaccgatggaccgcagccaagcta
cagttttctacagccctgggaggccttctgggggcctgctttgccatctgtacgcaatcc
cccaaaggagtagaggagacggtggtctggaccctgccctttacctcaggaggctttctc
tatgttgccctggtgaatgtgctacctgacctcttggaggaagatgacccatggcaccta
aatccccctctcccaacaggcactccctgcagcaggtgctgctgctctgctccggtatcg
tggtga

KEGG   Rattus norvegicus (rat): 300051
Entry
300051            CDS       T01003                                 
Symbol
Slc39a4
Name
(RefSeq) zinc transporter ZIP4 precursor
  KO
K14710  solute carrier family 39 (zinc transporter), member 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04978  Mineral absorption
rno05010  Alzheimer disease
rno05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    300051 (Slc39a4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    300051 (Slc39a4)
   05012 Parkinson disease
    300051 (Slc39a4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    300051 (Slc39a4)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   300051 (Slc39a4)
SSDB
Motif
Pfam: Zip ZIP4_domain
Other DBs
NCBI-GeneID: 300051
NCBI-ProteinID: NP_001071137
RGD: 1306701
Ensembl: ENSRNOG00000014314
UniProt: A0JPN2
LinkDB
Position
7:complement(108333380..108337553)
AA seq 656 aa
MLPKSLTQGLLLAMLVGTAAMVQPYHLLSLLTSGQGALDRTALDGLLNTLVARVHCTDGP
CEKCLSVETALALGKPDKPQLAPESVLESRYITYLSAAAALYLNDPEKTCKDIRAGLLAS
HVDDYLAKLESPEAMTLGLSQLLQKIEAHDASQPTREETCVDVPQLLEEAEEAGVSRSPG
LVLTALLDHVLNGSCFQGLPSPQYFVDFVFRQLSSKPRNITLPELEDLMHHLGVGGEDHS
DHGDHVDHSHLDREANHQDSELHATHNSSSSVWDTLCLSAKDVMAVYGLSEEAGVSPQAW
AQLTPALVQQQLSEACSSSPIIHVQDQLSQAERYLYGSLATLLICLCAVFGLLLLTCAKC
STATHYIMQTFLSLAVGALTGDALLHLIPKVLGLHTHSGEVHSHEEESIGGQSTWRLLAV
LGGFYIFFLFESFFNLLLPRDQDHEKDGPCSHGGHSHGISLQLSPSNLRQSKQPHESSRS
DLVTEETPELLNPDTRRLRAELRMLPYLITLGDAVHNFADGLAVGAAFSSTWKTGLATSL
AVFCHELPHELGDFAALLHAGLTVKRALLLNLASALTAFAGLYVALAVGVGEEGETWILA
VATGLFLYVALCDMLPAMMNVRDQRPWLLFLLHNVGLLGGWTILLLLSLYEDSITF
NT seq 1971 nt   +upstreamnt  +downstreamnt
atgctcccaaagtcgctcacacaggggctcttgttggcgatgctggtgggcacagcagca
atggtccagccctatcacctgctcagcctactcacctcgggccagggtgctctggatcga
acggcactggacggcctgttaaatacgctggtggcccgtgtgcactgcaccgacgggccg
tgtgaaaagtgtctgtctgtggagactgccttggctctaggcaaacctgataagccacag
cttgccccagaatcagtcctggagtccagatacattacttacctcagtgccgccgctgcc
ctctacctcaacgacccagagaaaacatgcaaggacatccgagctggcctcttggcctct
catgtggacgattacctggccaaactggagagtccagaggccatgaccctgggtctgagc
cagctactgcagaagattgaggcccatgatgccagccaacccaccagggaggagacctgt
gtagatgttccccaactgctggaggaggctgaggaagcaggggtttccagaagccctggc
ctggtcttgacagccttgctggatcacgtccttaatggatcctgcttccaaggcctgcct
agccctcagtactttgtggactttgtgttcaggcaactcagtagtaagcctcgcaatatc
acgctgcccgaattggaggatttgatgcatcaccttggggtgggtggagaggatcacagt
gaccatggtgaccatgttgaccacagtcatctggacagggaagccaaccaccaagactct
gagctccatgctacccacaacagcagctccagtgtatgggacacgctgtgcctgagtgcc
aaagatgtaatggctgtgtatgggctatctgaagaggccggggtgagccctcaggcctgg
gcccaactgacccctgccttggtccagcagcagctaagtgaagcctgcagctccagtccc
attatccatgtacaggaccagctcagtcaagcagagaggtatctgtatggctctctggcc
accctgctcatctgcctctgcgctgtgttcggtcttctgctgctgacctgtgccaaatgc
agcacagccacccactacatcatgcagaccttcctaagcttggctgtgggtgcactcaca
ggcgatgctctcctgcacctgatacccaaggtgctgggattgcacacgcatagtggagag
gttcactcccacgaggaggagagcattggtggacagtccacctggcgcctgctggctgta
cttggaggcttctacattttcttcctgtttgagagcttcttcaacctcttattgcccaga
gaccaggatcatgagaaagatgggccttgtagccacggtgggcacagccatggaatatca
ctgcagctatcacccagcaatctccggcaatccaaacagccccatgagagctctcgctca
gacttggtgacagaggagaccccggaactactgaacccagacacccggcgactgagagca
gagctgagaatgttgccctatctgatcacactgggtgacgccgtgcacaactttgctgat
gggctcgctgtgggcgcagccttctcatccacatggaagactgggctggccacctcattg
gcagtgttctgccatgagctgcctcacgaacttggggactttgctgctctgctgcatgcc
gggctgactgtgaaacgtgcgcttctgctgaatctggcctcagcgctcacagcattcgct
ggcctctacgtggctctagcagtcggagtaggcgaggagggcgagacttggattctggcg
gtagccactggcctcttcctttacgtggcgctctgtgacatgctcccagccatgatgaat
gtgcgggaccagcggccctggcttcttttcctgctccacaacgtgggtctgctgggcggc
tggaccatcctgctgctgctgtcattgtacgaagacagcatcaccttctga

KEGG   Rattus norvegicus (rat): 305846
Entry
305846            CDS       T01003                                 
Symbol
Slc39a2
Name
(RefSeq) zinc transporter ZIP2
  KO
K14709  solute carrier family 39 (zinc transporter), member 1/2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05010  Alzheimer disease
rno05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    305846 (Slc39a2)
   05012 Parkinson disease
    305846 (Slc39a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    305846 (Slc39a2)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   305846 (Slc39a2)
SSDB
Motif
Pfam: Zip DUF485
Other DBs
NCBI-GeneID: 305846
NCBI-ProteinID: NP_001100730
RGD: 1306291
Ensembl: ENSRNOG00000010375
UniProt: D3ZIN1
LinkDB
Position
15:24590738..24592850
AA seq 309 aa
MEVLPGVKIGCVLALLVFTLGCGLTPIYVKWFQTDAATGHHHRVLSLLGCTSAGVFLGAG
LMHMTAEALEGIESEIQKFVVQNSTGSKGNSSRDAAASYVEYPYGELVISLGFFFVFLLE
SLALQCCHGAAGGSTVQEEEWGGTHAFGFHKHPPIPSPSRGPLRALILLLSLSFHSVFEG
LAVGLQATVAATVQLCVAVLAHKGLVVFSVGLRLVKIGTGPRWATFCILSLALMSPVGLA
LGLTVAGGASGQAQELAQAILEGIAAGTFLYVTFLEILPRELACPEAPLAKYGCVAAGFA
FMALIALWA
NT seq 930 nt   +upstreamnt  +downstreamnt
atggaggtgctaccaggagttaaaattggctgtgtgcttgccctcctggttttcacactg
ggctgtggtcttactcccatctacgtcaaatggttccagacggatgcagcaacaggtcac
caccacagggttctcagcctcctgggctgcacctctgccggtgtcttcctgggagcaggg
ttgatgcatatgactgctgaagccctggagggaattgagtcagaaattcagaaattcgtg
gtgcagaatagtacaggaagtaaggggaattcttctcgtgatgctgctgccagttacgtg
gagtacccctacggagaacttgtcatctccctgggctttttctttgtcttccttttggag
tcgctggccttgcagtgctgtcacggtgctgctggaggatcgacagtacaggaggaggaa
tggggagggactcatgccttcggattccacaagcatccacccataccctcaccctcacgg
ggtcccctccgcgccctcatccttctgctctcgctgtcctttcattccgtattcgaaggt
ctagctgtgggactgcaggcaaccgtggcagctactgtacagctctgcgttgctgtgctg
gctcataaggggcttgtggtgttcagcgtgggcctgaggctggtgaagatcggcactgga
ccacgatgggccacgttctgcatactgtccttagctctcatgtctcctgtgggcctagcc
ctagggctgaccgtggctggtggagcctcaggacaagcacaggaattagcccaggcgata
ttagagggcatagcagctggcacgtttttatatgtcaccttcctagaaattttgccccgg
gagctggcttgtcctgaggcccctctggccaagtatggctgtgtggctgccgggtttgcc
ttcatggcccttattgctttgtgggcctga

KEGG   Rattus norvegicus (rat): 306009
Entry
306009            CDS       T01003                                 
Symbol
Slc39a14
Name
(RefSeq) zinc transporter ZIP14 precursor
  KO
K14720  solute carrier family 39 (zinc transporter), member 14
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04216  Ferroptosis
rno05010  Alzheimer disease
rno05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    306009 (Slc39a14)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    306009 (Slc39a14)
   05012 Parkinson disease
    306009 (Slc39a14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    306009 (Slc39a14)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   306009 (Slc39a14)
SSDB
Motif
Pfam: Zip Claudin_2 DUF808
Other DBs
NCBI-GeneID: 306009
NCBI-ProteinID: NP_001100745
RGD: 1307026
Ensembl: ENSRNOG00000009832
UniProt: D3ZZM0
LinkDB
Position
15:complement(45376806..45423549)
AA seq 490 aa
MVTMERLHPAFPSYLLLVLFGIWRTVPQIHASSTGLLPLSATSFLEELMKRYGENDSLTL
PQLKTLLNSVGVGRDNVSLPKEAHRNLSTCFSSGDLFAAHNFSERSRIGKSEFQEFCPTI
LQQLDSRACTPENQENKENEQTEEGKPSAIEVWGFGFLSVSLINLASLLGVLVLPCTEKA
FFSRVLTYFIALSIGTLLSNALFQLIPEAFGFNPQDNYVSKSAVVFGGFYLFFFTEKILK
MLLKQKNEHHHGHNHFTSETLPSKKDQEEGVTEKLQNGDLDHMIPQHCNNDLDGKAPSTD
EKVIVGSMSVQDLQASQSACYWLKGVRYSDIGTLAWMITLSDGLHNFIDGLAIGASFTVS
VFQGISTSVAILCEEFPHELGDFVILLNAGMSIQQALFFNFLSACCCYVGLAFGILAGSH
FSANWIFALAGGMFLYIALADMFPEMNEVCQEDEKKDSFLVPFVIQNLGLLTGFSIMLVL
TMYSGQIQIG
NT seq 1473 nt   +upstreamnt  +downstreamnt
atggtcaccatggagcggctacacccagccttccctagctacctcctgttggtgctgttt
ggtatatggagaactgtcccccagattcatgcctcatctactggcctgctgcccctcagt
gccacctctttcctggaagagcttatgaaacgctacggagagaatgacagccttaccttg
ccacagctgaagactctgctcaacagcgtgggcgtgggccgggataatgtttccctgccc
aaagaagcacacaggaacctctccacgtgctttagctctggagatctctttgcggcccac
aacttcagtgagcgatctcgtattgggaagagtgaattccaggagttctgccccaccatt
ctccagcagttggattcccgggcttgcaccccagaaaaccaggagaataaggaaaatgag
cagacagaggaggggaagccaagcgccattgaagtgtggggctttgggttcctcagtgtc
tcactgattaacctggcctcgctcctgggagtcctggtcctgccatgcacggagaaagcg
tttttcagccgtgtgctcacttacttcatcgccttgtccattggaacgctgctctctaac
gcacttttccagctcatcccagaggcttttggtttcaaccctcaggacaattatgtctcc
aagtctgctgtggtctttgggggtttctaccttttctttttcacagaaaagatcctgaag
atgctcctgaagcagaaaaacgagcaccatcacggacataaccattttacctccgaaacg
cttccttccaagaaggaccaggaggagggtgtcacggagaagctacagaatggggacctg
gatcatatgattcctcagcactgcaacaatgatctggatggcaaggcacccagcacagac
gagaaggtcatcgtaggctccatgtctgtgcaggacctgcaggcatcccagagtgcttgc
tactggctcaaaggggttcgatattctgatattggtaccttggcctggatgatcaccctg
agcgatggtctccacaatttcatcgatggcctggctatcggtgcctccttcactgtgtct
gtcttccaaggcattagcacgtcggtggccattctctgtgaggaatttcctcacgagctg
ggagacttcgttatcctgctcaatgctggtatgagtatccagcaggccctcttcttcaac
ttcctctctgcttgctgctgctatgtgggtctggcctttggtatcctggctggcagtcac
ttctctgcaaactggatttttgcactggctggaggaatgttcttgtatattgctctagcc
gatatgttccctgagatgaatgaggtgtgccaggaggatgagaagaaggacagctttttg
gtccccttcgtcatccagaatcttggcctcctaactggcttctccatcatgctggttctc
accatgtattcagggcagattcagatcgggtag

KEGG   Rattus norvegicus (rat): 314275
Entry
314275            CDS       T01003                                 
Symbol
Slc39a9
Name
(RefSeq) zinc transporter ZIP9
  KO
K14715  solute carrier family 39 (zinc transporter), member 9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05010  Alzheimer disease
rno05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    314275 (Slc39a9)
   05012 Parkinson disease
    314275 (Slc39a9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    314275 (Slc39a9)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   314275 (Slc39a9)
SSDB
Motif
Pfam: Zip
Other DBs
NCBI-GeneID: 314275
NCBI-ProteinID: NP_001030101
RGD: 1311236
Ensembl: ENSRNOG00000005052
UniProt: Q3KR82
LinkDB
Position
6:100291577..100330419
AA seq 287 aa
MDDFLSISLLSLAMLVGCYVAGIIPLAVNFSEERLKLVTVLGAGLLCGTALAVIVPEGVH
ALYEEVLEGKHHQASEAKQNVIASDKAAEISVVHEHEHSHDHTQLHAYIGVSLVLGFVFM
LLVDQIGSSHVHSTDDPESARPSSSKITTTLGLVVHAAADGVALGAAASTSQTSVQLIVF
VAIMLHKAPAAFGLVSFLMHAGLERNRIRKHLLVFALAAPAMSMLTYLGLSKSSKEALSE
VNATGVAMLFSAGTFLYVATVHVLPEDTSTNQSGSSLSPRPLPSGKN
NT seq 864 nt   +upstreamnt  +downstreamnt
atggatgactttctctccattagtctgctgtctttggcaatgttggtgggatgttacgtg
gctggaatcattcctttggctgttaatttctcagaggaacggctgaagctggtgactgtg
ttgggtgctggccttctctgtggaactgcactggcagtcatcgtgccggaaggggtgcat
gcactttatgaggaggtcctggagggaaaacaccaccaagccagtgaagcgaagcagaat
gtgattgcatcagacaaagcagcagaaatatcagttgtccatgagcatgagcacagccac
gaccacacacagctgcatgcctacattggtgtgtccctggtactgggcttcgttttcatg
ttgctcgtggaccagattggcagctcccatgtgcattccactgacgatccagaatcagca
aggcccagcagttccaaaatcaccaccacactggggctggttgtccatgctgcagctgat
ggtgtagctttgggagcagcagcctctacttcacagaccagtgtccagttaattgtgttc
gtggcaataatgctacataaggctccagcagcatttgggctggtttccttcctgatgcat
gctggcctggagcggaatcgaatcagaaagcacttgctggtctttgcactggcagcacca
gccatgtccatgctgacgtacttaggattaagtaagagcagtaaagaagccctttcagag
gtcaatgccactggagtggccatgcttttctctgccgggacatttctttacgttgccacc
gtccatgtcctccctgaggacaccagcactaaccagtcaggttccagcctcagtccacgg
ccattgccatcggggaagaactag

KEGG   Rattus norvegicus (rat): 314637
Entry
314637            CDS       T01003                                 
Symbol
Slc39a3
Name
(RefSeq) zinc transporter ZIP3
  KO
K14709  solute carrier family 39 (zinc transporter), member 1/2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05010  Alzheimer disease
rno05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    314637 (Slc39a3)
   05012 Parkinson disease
    314637 (Slc39a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    314637 (Slc39a3)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   314637 (Slc39a3)
SSDB
Motif
Pfam: Zip IF2_N
Other DBs
NCBI-GeneID: 314637
NCBI-ProteinID: NP_001008357
RGD: 1310863
Ensembl: ENSRNOG00000045524
UniProt: Q5U1X7
LinkDB
Position
7:8676845..8682846
AA seq 317 aa
MSQLLVAKVLCMVGVFFFMLLGSLLPVKVIEADFEKAHRSKKVLSLCNTFGGGVFLATCF
NALLPAVRDKLQQVLSLGHISTDYPLAETLMMVGFFLTVFVEQLVLTFRRERPPFIDLET
FNAGSDAGSDSEYESPFVGVGGRNHGLYPEPTAHSHGTGLRLRELGRPGPLRLLSLVFAL
SAHSVFEGLALGLQEEGERVVSLFVGVAVHETLVAVALGISMARSAVPLRDAAKLAVTVS
AMIPVGIGLGLGIESARSVASSVASALLQGLAGGTFLFVTFLEILAKELEERSEQLLKVL
FLVLGYAVLAGMVFLKW
NT seq 954 nt   +upstreamnt  +downstreamnt
atgtcacagctcctggtggctaaggtcctctgcatggtgggtgtgttcttcttcatgctg
ctgggctctctgctgcctgtgaaggtcatcgaggccgacttcgagaaggcacaccgctcc
aagaaggtcctctccctctgtaacacctttgggggtggcgtcttcctggctacatgcttt
aatgcactgctgcctgcagtgagggacaagctgcagcaggtactgagcctgggccacatc
agcactgactacccgctggccgagaccctcatgatggtggggttcttcctcactgtgttc
gtggagcagctggtgctgaccttccgccgggagcggcctccctttatagacctggagacc
ttcaatgctggctcagacgccggcagcgactcggagtacgagagcccatttgtgggtgtg
ggcggccgtaaccacggcctgtaccccgagcccactgcacacagccatggcacagggctg
cggctgcgggagctgggccgccctgggccgctgcggctgctcagcctggtcttcgcgctg
tctgcacactcggtgtttgagggcctggcgctggggctgcaggaggagggtgagcgtgtg
gtcagcctgttcgttggtgtggcggtccatgagacgctggtggctgtggccctgggcatc
agcatggcccgaagtgcagtacccctgagggacgcggccaagttggcggtgaccgtgagc
gccatgatcccggtgggcattgggctgggcctgggcatcgagagtgcccgcagcgtggcc
agcagcgtggcatcggcgctgctgcagggcttggctggaggcaccttcctgttcgtcacc
ttcctggagatcctggccaaggaactggaggagaggagcgagcagctgctgaaggtgctg
ttcctggtgctgggctacgcagttctggccggcatggtctttctcaagtggtga

KEGG   Rattus norvegicus (rat): 361986
Entry
361986            CDS       T01003                                 
Symbol
Slc39a1
Name
(RefSeq) zinc transporter ZIP1
  KO
K14709  solute carrier family 39 (zinc transporter), member 1/2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05010  Alzheimer disease
rno05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    361986 (Slc39a1)
   05012 Parkinson disease
    361986 (Slc39a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    361986 (Slc39a1)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   361986 (Slc39a1)
SSDB
Motif
Pfam: Zip YLATT
Other DBs
NCBI-GeneID: 361986
NCBI-ProteinID: NP_001128049
RGD: 1305241
Ensembl: ENSRNOG00000059463
UniProt: B5DEF5
LinkDB
Position
2:175703413..175709063
AA seq 324 aa
MGPWGEPELLVWRPEAIASEPSVPVGLEVKLGALVLLLLLTLICSLVPVCVLRRSGANHE
ASASGQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEALEALHVTLQFPLQEFILAMGF
FLVLVMEQITLAYKEQSSPPHPEETRALLGTVNGGPQHWHDGPGIPQASGTPAAPSALRA
CVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRAQVVA
GCGILFSCMTPLGIGLGAALAESAGPLHQLAQSVLEGMAAGTFLYITFLEILPQELATSE
QRILKVILLLAGFALLTGLLFVQV
NT seq 975 nt   +upstreamnt  +downstreamnt
atggggccctggggggagcccgagctcctggtgtggcgcccagaagcgatcgcatcggag
ccctcggtgccagtggggctggaggtgaagctgggggccctggtgctgctgttgctgctg
acactcatctgcagcctggtacctgtctgtgtgcttcgaaggtcaggcgctaaccatgaa
gcctctgcttcaggccagaaagctttaagcctagtgagctgcttcgcaggaggagtcttc
ctggctacctgtcttctggacttgctgcctgactacctggctgccatagatgaggccttg
gaggctcttcatgtgacgcttcagttccccttgcaagagttcatcctggccatgggtttc
ttcctggtgttggtgatggagcagatcacactggcttataaggagcagtccagtccacca
catccggaagagacgagagctctactgggaacagtgaatggtgggcctcaacattggcat
gatggaccagggatcccccaggccagcggaaccccagcagctccctcagccctgcgtgcc
tgtgtactggtcttctccttagccttgcactctgtatttgagggcctggctgtagggttg
cagagagacagggctcgagcaatggagctgtgcctagctttgctgctccacaagggtatc
ctggcagtcagtctgtccctgcggcttctacagagccacctacgagcgcaggtggtggct
ggctgtgggatcctcttctcctgtatgacacctctgggcattgggctgggtgcagctctg
gcagagtcagctgggcctctccaccagctggcccagtctgttctggagggcatggcagct
ggcaccttcctctatatcaccttcctggaaatcctaccccaggagttggccacgtctgag
cagaggatcctcaaggtcattctgctcctagcaggctttgccctgctcaccggcctgctc
tttgtccaagtctaa

KEGG   Rattus norvegicus (rat): 362812
Entry
362812            CDS       T01003                                 
Symbol
Slc39a5
Name
(RefSeq) zinc transporter ZIP5 precursor
  KO
K14711  solute carrier family 39 (zinc transporter), member 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05010  Alzheimer disease
rno05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    362812 (Slc39a5)
   05012 Parkinson disease
    362812 (Slc39a5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    362812 (Slc39a5)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   362812 (Slc39a5)
SSDB
Motif
Pfam: Zip
Other DBs
NCBI-GeneID: 362812
NCBI-ProteinID: NP_001102198
RGD: 1310322
Ensembl: ENSRNOG00000033361
UniProt: D3ZSF7
LinkDB
Position
7:complement(822873..830865)
AA seq 533 aa
MGPPVHHLLAGLCVGVALGWVEGSVPNLGPAEQEQNHYLAQLFGLYGENGTLTAGGLARL
LHSLGLGRVQGLRLGHQEPPTGRAAPMSGDNFTHRLQELELSVDVWAGMPLSPSGWGDQE
DSKAHDLHGSGPSGLDLFHRLLLLDHSLADHLNEDCLNGSQLLVNFGLSPVAPLTPRQFA
LLCPALLYQIDSRVCIKTPAPAPPGDALSALLHSGLAVLFLSLPAPFSLLLLRLLGPRLL
RPVLGFLGALAVGTLCGDALLHLLPHAQGGRHTGPSEQAEEDLGPGLSVLGGLFLLFVLE
NALGLVRHRGLRPRCGRNKRDVEEPNPDPEDGTGMVLRPLQAASEVQGQRENSQSLPSPA
PPGYQGHSHEHRGGSIAWMVLLGDCLHNLTDGLALGAAFSDGFSSGLSTTLAVFCHELPH
ELGDFAMLLQEGLSFRKLLLLSLVSGVLGLGGAALGVGLSLGPVPLTPWVFGITAGVFLY
VALVDMLPALLRPPEPRPLPHVLLQGLGLLLGGSLMFTIALLEEQLLPVVPDG
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggggccccccgtacatcatctgttggctggcctgtgtgtgggggtggccttgggctgg
gtagaaggctcagtccccaacctgggcccagccgaacaggaacagaaccactacctggcc
cagctgttcggtctatatggagagaatgggacattgactgctgggggcctggcccggctt
ctccacagcctaggactgggccgagttcaggggctccgcctgggacaccaagagcctcca
actgggcgggctgcacccatgagtggcgacaatttcacacacaggcttcaggaactggag
ctgagtgtggatgtctgggcaggaatgcctctgagcccttcaggttggggtgaccaggag
gactcaaaggcacatgacctgcatgggtcagggccctcgggcctagacctcttccacagg
cttctgctgctggaccattcgttggctgaccatctgaacgaggattgtctgaatggttcc
cagctgctggtcaattttgggctgagtcctgttgctcctctgacccctcgtcagtttgct
ctgttgtgcccagccctgctttatcagattgacagccgtgtttgcatcaaaacccctgct
ccagcacctccaggggatgcactgtctgccctgcttcatagtggcctggcagtcctgttc
ctcagcctccctgctcccttctccctgctgctgctgcggctcttaggacctcgtctgttg
cggcctgtgctgggcttcctgggggccctggctgtgggcactctttgtggggatgccctg
ctccacctgctgccacatgcacaaggaggacggcacacaggacctagtgagcaagcagag
gaggatctgggtccagggctgtcagtgcttggtggcctcttcctgctcttcgtgttagag
aatgcactaggacttgtgcggcacagagggctcaggccaaggtgtggcaggaacaaaagg
gatgtcgaagaaccaaaccctgacccagaggacggcactgggatggtccttcggccccta
caggcagcttcagaggttcagggccagagggaaaacagccagtccctaccatctccagcc
cctcccggataccaaggccacagtcatgagcaccggggcggtagtatcgcatggatggtc
ctcctgggagattgcctgcacaacctcaccgatgggctcgcactaggtgctgccttttcc
gacggcttctccagtggcctcagcactaccctagcagtcttctgccatgagctgccccat
gaactgggtgactttgcaatgctgcttcaggaagggctgtcctttcggaagctgctgctg
ctgagcctcgtctctggagtcctggggctggggggtgcagccctgggggtggggctcagc
ttgggccctgtccccctcactccctgggtgtttgggatcacggctggggtcttcctctat
gtggcccttgtggatatgctgccagccctgctccgtcctcctgagccccggcccctgccc
catgtgcttctgcaggggctggggctgctgctggggggcagcctcatgtttactatagcc
ctgttggaggaacagctactgcccgtggttcctgatggctga

KEGG   Rattus norvegicus (rat): 363229
Entry
363229            CDS       T01003                                 
Symbol
Slc39a10
Name
(RefSeq) zinc transporter ZIP10 precursor
  KO
K14716  solute carrier family 39 (zinc transporter), member 10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05010  Alzheimer disease
rno05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    363229 (Slc39a10)
   05012 Parkinson disease
    363229 (Slc39a10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    363229 (Slc39a10)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   363229 (Slc39a10)
SSDB
Motif
Pfam: Zip Mntp
Other DBs
NCBI-GeneID: 363229
NCBI-ProteinID: NP_001102266
RGD: 1307321
Ensembl: ENSRNOG00000011677
UniProt: D4A517
LinkDB
Position
9:54836841..54960325
AA seq 834 aa
MKVHIHTKFCLICLLTFIFHHCNHCHEDHDHGPEELHRHHRGMTESESSTFSVQDAENEK
KYYIEKLFDRYGENGRLSFFGLEKLLTNLGLGEIKVVEINHEDLGHDHVSHLDILAVQEG
KHFHSHNHQHFHNHLNAENHTATSITSKRNHKCDPEREAAEVPIKPEDKHPHDRNHRFHH
RHRLHHHLDHNTTRRVHNDSIAHSEHGEPGHGPSTETNKTQEQSEVKSGKVRRKEKGKRK
KENSEVNTPGFLPTHGHGEQYEHNRVHKLDRVHSPGHPHAHLPEHSGHELGHGHQEFDPD
NEGELRHTRKREAPHVKKSAIYSTPSHKDHNEDDRQHECLNVTQLLKHFGLGPSSPISPD
LFTYLCPALLYQIDSRLCIEHFDKLLVEDLNKDKALVPEDKANIGASAWICGIISITVIS
LLSLLGVILVPIINQGCFKFLLTFLVALAVGTMSGDALLHLLPHSQGGHDHSHQHAHGHG
HSHGHESKKFLEEYDAVLKGLVALGGIYLLFIIEHCIRMFKHYKQQRGKQKWFMKQSTEE
STIGRKLSDHKLNSTPDADWLQLKPLAGTDDSVVSEDRLNETELTDLEAQQESPPKNYLG
VEEEKIMDHSHSDGLHTIHEHEVHVVSHNHRDEEDTAVLRKHGHQWHHRHAHHSHGPCHS
GSDLKETGIANIAWMVIMGDGIHNFSDGLAIGAAFSAGLTGGISTSIAVFCHELPHELGD
FAVLLKAGMTVKQAIVYNLLSAMMAYIGMLIGTAVGQYANNITLWIFAITAGMFLYVALV
DMLPEMLHGDGDHEEHGFCPVGQFILQNLGLLFGFALMLVIALYEDRIVFDIQF
NT seq 2505 nt   +upstreamnt  +downstreamnt
atgaaggtgcatatacacacaaaattctgtctcatctgtttgctgacgtttattttccat
cattgcaaccactgccatgaagaccatgaccatggccccgaggagcttcacaggcaccac
cgtggaatgacagagtcagagtcaagcacattttcagtgcaggatgctgaaaatgaaaaa
aagtactatattgaaaaactgtttgaccgttacggtgaaaatggaagattatcctttttc
ggtctggagaaacttttaacaaacttgggccttggagagatcaaagtcgttgagattaat
catgaggaccttggccatgatcatgtttctcacttagacattctggccgttcaagaggga
aagcatttccactcccataaccaccagcattttcacaatcatttaaatgcagaaaaccac
actgcgaccagtataacatcaaaaagaaaccacaagtgtgatccagagagagaggcagct
gaagtgcccatcaaacccgaggataaacacccgcacgaccgcaatcaccgcttccatcat
cgccatcgtttgcatcatcacctggaccataacaccactcggcgggttcacaatgactcc
atcgctcacagcgagcatggggagccgggtcacggcccttcaacagagaccaataaaaca
caagaacaatctgaagtgaagtcagggaaggtcaggaggaaggaaaaagggaagaggaaa
aaggaaaactctgaggttaacacaccaggtttcctccccacccatggtcacggtgaacaa
tatgagcataatcgggttcacaaacttgaccgtgtacatagcccgggccatcctcatgca
catcttcccgagcacagtggccatgagcttggccatggacaccaagaatttgatcctgat
aatgaaggtgaacttcgacatactcgaaagcgagaagcaccacatgttaaaaaaagtgca
atttattccactcctagccacaaagaccacaatgaagatgaccgccaacatgaatgtttg
aacgtcactcagttgttaaagcactttggcctgggtcccagctcccccatctcgcctgat
ctattcacatacctttgcccggccttgctgtaccagatcgacagcagactttgtattgaa
cattttgacaaacttttagttgaagatttaaataaggataaagctctggttcctgaagat
aaggcaaacataggggcatcagcgtggatctgtggcatcatctccatcaccgttattagt
ctgctctccttgctgggtgtgattttggttcccatcatcaaccaaggatgcttcaaattc
cttctcacgttcctcgttgcgctagctgtaggaacaatgagtggagacgcccttctgcat
ctactgccccattctcagggcggacatgaccacagtcatcagcatgctcacgggcatggt
cattcacatggacatgaatctaagaagtttctggaagaatatgatgctgtgttgaaagga
cttgttgcactaggaggcatttacttactgttcatcatcgagcactgcatccggatgttt
aagcactacaagcagcaacgaggaaagcagaaatggtttatgaagcagagtacagaagaa
tcaactattggaagaaagctttcagatcataagttaaacagcacaccggatgctgactgg
ctgcaactcaagccccttgctggaacagatgactcggtggtttctgaagaccgacttaat
gagaccgaactgactgatttagaagcccaacaagaatcccctcctaaaaattaccttggt
gtagaggaagagaaaatcatggaccattctcacagtgatggattgcacaccattcatgag
cacgaggtccatgtagtctctcataaccaccgcgatgaggaggatacagctgtgctgagg
aagcatggccaccagtggcaccaccgacacgcccaccattcccacgggccctgccactct
ggctcagacctgaaggaaacaggaatagccaacatagcctggatggtgatcatgggggac
ggcatccacaacttcagtgatggcctcgccattggggcagctttcagtgccgggctgact
ggaggcatcagcacttccatagccgtcttctgccatgaactgccacacgagttaggtgat
tttgcagttcttctgaaagcaggcatgaccgtaaagcaagccattgtgtacaacctgctg
tctgccatgatggcttacataggaatgctcataggcacggctgtcggtcagtacgccaac
aacatcacactctggatcttcgcgatcacggcaggcatgttcctctacgtggccttggtg
gatatgcttccagagatgctgcatggagatggcgaccacgaggagcacggcttctgtcca
gttgggcagttcattcttcagaatctaggactgctgtttggattcgccctcatgctggtt
atcgccctctacgaagacagaatcgtgtttgacatccagttctga

DBGET integrated database retrieval system