KEGG   Rattus norvegicus (rat): 288227
Entry
288227            CDS       T01003                                 
Symbol
Bace2
Name
(RefSeq) beta-secretase 2 precursor
  KO
K07747  beta-site APP-cleaving enzyme 2 (memapsin 1) [EC:3.4.23.45]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    288227 (Bace2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    288227 (Bace2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.45  memapsin 1
     288227 (Bace2)
Peptidases and inhibitors [BR:rno01002]
 Aspartic peptidases
  Family A1: pepsin family
   288227 (Bace2)
SSDB
Motif
Pfam: Asp TAXi_C TAXi_N
Other DBs
NCBI-GeneID: 288227
NCBI-ProteinID: NP_001002802
RGD: 1303241
Ensembl: ENSRNOG00000001953
UniProt: Q6IE75
LinkDB
Position
11:36707473..36789550
AA seq 514 aa
MGALLRALLLPLLAQWLLRAVPVLAPAPFTLPLQVAGAANHRASTVPGLGTPELPRADGL
ALALEPARATANFLAMVDNLQGDSGRGYYLEMLIGTPPQKVRILVDTGSSNFAVAGAPHS
YIDTYFDSESSSTYHSKGFEVTVKYTQGSWTGFVGEDLVTIPKGFNSSFLVNIATIFESE
NFFLPGIKWNGILGLAYAALAKPSSSLETFFDSLVAQAKIPDIFSMQMCGAGLPVAGSGT
NGGSLVLGGIEPSLYKGDIWYTPIKEEWYYQIEILKLEIGGQSLNLDCREYNADKAIVDS
GTTLLRLPQKVFDAVVEAVARTSLIPEFSDGFWTGAQLACWTNSETPWAYFPKISIYLRD
ENASRSFRITILPQLYIQPMMGAGFNYECYRFGISSSTNALVIGATVMEGFYVVFDRAQR
RVGFAVSPCAEIAGTTVSEISGPFSTEDIASNCVPAQALNEPILWIVSYALMSVCGAILL
VLILLLLFPLHCRHAPRDPEVVNDESSLVRHRWK
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgggcgcgctgcttcgagcactcttgctcccactgctggcgcagtggctcttgcgcgcg
gtccccgtgctggccccggcgcccttcacgcttcccctccaagtggccggggccgcgaac
cacagagcctcaactgttcccgggctcgggacccccgagttgccccgggctgatggcctg
gccctcgcactggagcctgccagggctaccgccaacttcttggctatggtggacaatctt
cagggggactctggccgcggctactacctggagatgctgattgggacccctccgcaaaag
gtacggattcttgtggacaccggaagcagtaacttcgcagtggcaggtgccccacactcc
tacatagacacctactttgactcagagagctccagcacataccactccaagggctttgag
gtcacggtgaagtacacacagggaagctggactggatttgttggtgaggaccttgtcacc
atcccaaaaggcttcaacagctctttcttggtcaatattgccactattttcgagtctgag
aatttctttttgcctgggattaagtggaatggaatccttggactcgcttatgctgccttg
gccaagccatcaagctctctggagactttttttgattccctggtggcccaagcaaaaatt
ccggacattttctccatgcagatgtgcggggctggattgccagtagctggatctggtacc
aacggaggtagtcttgtcctgggtgggattgaaccaagtttgtataaaggagatatatgg
tataccccaattaaagaggaatggtactatcaaatagagatcttgaaattggaaattgga
ggccagagcctcaacctggactgcagagagtataacgcagacaaggccattgtggacagc
ggcaccacactcctgcgcctgccccagaaggtgtttgatgcagtggtggaagccgtggca
cgcacatctctgattccagagttttctgatggcttctggacgggggcccagctggcatgc
tggacaaattctgaaactccatgggcgtatttccctaagatttctatctacctgagagat
gagaacgccagtcgctccttccgaatcaccattctgccgcagctctacattcagcccatg
atgggagctggtttcaattatgagtgctaccgttttggtatctcctcttccacaaatgcg
ctggtgattggtgccaccgtgatggagggattctacgtggtctttgacagagctcagagg
agggtgggctttgcagtgagtccctgtgcagagattgcaggtaccacagtgtctgaaatt
tctgggcccttttccacggaagacatagccagcaactgtgttccagcacaggctctgaat
gagcccatcttgtggattgtgtcctatgccctgatgagtgtgtgtggagccattctcctg
gttctgatcctcctgctgctgttcccgctgcactgccgacacgccccccgagaccctgag
gtggttaacgatgaatcctcactagtcagacatcgctggaaatga

KEGG   Rattus norvegicus (rat): 29392
Entry
29392             CDS       T01003                                 
Symbol
Bace1
Name
(RefSeq) beta-secretase 1 precursor
  KO
K04521  beta-site APP-cleaving enzyme 1 (memapsin 2) [EC:3.4.23.46]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29392 (Bace1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    29392 (Bace1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.46  memapsin 2
     29392 (Bace1)
Peptidases and inhibitors [BR:rno01002]
 Aspartic peptidases
  Family A1: pepsin family
   29392 (Bace1)
SSDB
Motif
Pfam: Asp TAXi_C TAXi_N
Other DBs
NCBI-GeneID: 29392
NCBI-ProteinID: NP_062077
RGD: 2191
Ensembl: ENSRNOG00000016847
UniProt: P56819
LinkDB
Position
8:46142060..46166268
AA seq 501 aa
MAPALRWLLLWVGSGMLPAQGTHLGIRLPLRSGLAGPPLGLRLPRETDEEPEEPGRRGSF
VEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSST
YRDLRKSVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGIL
GLAYAEIARPDDSLEPFFDSLVKQTHIPNIFSLQLCGAGFPLNQTEALASVGGSMIIGGI
DHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKK
VFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRIT
ILPQQYLRPVEDVATSQDDCYKFAVSQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSAC
HVHDEFRTAAVEGPFVTADMEDCGYNIPQTDESTLMTIAYVMAAICALFMLPLCLMVCQW
RCLRCLRHQHDDFADDISLLK
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggccccggcgctgcgctggctcctgctatgggtgggctcgggaatgctgcctgcccag
ggaacccatctcggtatccgactgccccttcgcagcggcctggcagggccacccctgggc
ctgaggctgccccgggagacggacgaggaacctgaggagcctggccggagaggcagcttt
gtggagatggtggacaacctgaggggaaagtccggccagggctactatgtggagatgacc
gtgggcagccccccacagacgctcaacatcctggtggacacgggcagtagtaattttgca
gtgggggctgccccacaccctttcctgcatcgatactaccaaaggcagctgtccagtaca
taccgagacctccgaaagtctgtgtatgtgccctacacccagggcaagtgggagggggaa
ctgggcactgacctggtgagcatccctcatggccccaacgtcactgtgcgtgccaacatt
gctgccatcactgaatcggacaagttcttcatcaatggttccaactgggagggcatccta
gggctggcctatgctgagattgccaggcctgacgactccttggagcccttttttgactcc
ctggtgaagcagacccacattccgaacatcttttccctgcagctctgtggcgctggcttc
cccctcaaccagactgaggcactggcctcggtgggagggagcatgatcattggtggtatc
gaccattccctatacactggcagtctctggtacacacccatccggcgggagtggtattat
gaagtgatcattgtacgtgtagaaatcaatggtcaagatctgaaaatggactgcaaggag
tacaactatgacaagagcatcgtggacagtggcaccaccaaccttcgtttgcccaagaaa
gtatttgaagctgcagtcaagtccatcaaggcagcctcctcgacggagaagttcccggat
ggcttttggctaggggagcagctggtgtgctggcaagcaggcacgaccccttggaacatt
ttcccagtcatttcactttacctcatgggtgaagtcaccaatcagtccttccgcatcacc
atccttcctcagcaatacctacggccagtggaagatgtggccacgtcccaagacgactgt
tacaagttcgccgtctcacagtcatccacaggcaccgttatgggagcggtcatcatggaa
ggcttctatgtggtctttgatcgagcccgaaagcgaattggctttgctgtcagcgcttgc
catgtgcacgatgagttcaggacggcggcagtggaaggtccgtttgtcacggcagacatg
gaagactgtggctacaacattccacagacagatgagtcgacacttatgaccatagcctat
gtcatggctgccatctgcgccctcttcatgttgccactctgcctcatggtatgtcagtgg
cgctgcctacgctgcctgcgccatcagcatgatgactttgctgatgacatctccctgctg
aaataa

DBGET integrated database retrieval system