KEGG   Rattus norvegicus (rat): 289036
Entry
289036            CDS       T01003                                 
Symbol
Adipor1
Name
(RefSeq) adiponectin receptor protein 1
  KO
K07297  adiponectin receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04920  Adipocytokine signaling pathway
rno04932  Non-alcoholic fatty liver disease
rno04936  Alcoholic liver disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    289036 (Adipor1)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    289036 (Adipor1)
  09149 Aging
   04211 Longevity regulating pathway
    289036 (Adipor1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    289036 (Adipor1)
   04932 Non-alcoholic fatty liver disease
    289036 (Adipor1)
SSDB
Motif
Pfam: HlyIII DUF4405 Mpo1-like
Other DBs
NCBI-GeneID: 289036
NCBI-ProteinID: NP_997470
RGD: 1303151
Ensembl: ENSRNOG00000004143
UniProt: Q6P746
LinkDB
Position
13:45859461..45879248
AA seq 375 aa
MSSHKGSAVAQGNGAPSSNRAADTVELAELGPLLEEKGKRAATSPAKAEEEQACPVPQEE
EEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPS
FRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGA
VLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLS
IVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQM
GWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQE
FRYGLEGGCTDDSLL
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgtcttcccacaaaggatctgccgtggcccagggcaatggggctccttctagtaacaga
gcagcggacacggtggagctggctgagctggggcccctgctggaggagaagggtaagcgg
gcagccaccagcccagccaaggctgaagaagaacaagcatgccccgtgcctcaggaggag
gaggaggaggtgcgggtgctgacccttcctctgcaagcccaccatgccatggagaagatg
gaggagttcgtatataaggtctgggaggggcgttggagggtcatcccatacgatgtgctt
cctgactggctgaaagacaatgactacctgctacatggccacagaccacctatgccctcc
ttccgggcttgcttcaagagcatcttccgcatccacacagaaactggcaacatctggaca
catttgcttggttttgtgctatttctctttctgggaatcttgaccatgctcagaccaaat
atgtacttcatggctcccctccaggagaaggtggtcttcgggatgttcttcctgggtgca
gtgctctgcctcagcttctcctggcttttccacaccgtctactgtcattcagagaaggtc
tctcgcactttttccaaactggactattcagggattgctctactgattatggggagcttc
gtcccctggctctattactccttctactgctccccacagccacggctcatctacctctcc
atcgtctgtgtcctgggcatctctgccatcattgtggcacagtgggaccggtttgccact
cccaagcaccggcagacaagagcaggagtgttcctgggacttggcttgagtggtgttgta
cccaccatgcactttactatcgctgagggctttgtcaaggccaccacagtgggccagatg
ggctggttcttcctcatggctgtgatgtacatcaccggcgctggcctttatgctgctcgg
attcctgagcgcttctttcctggaaaatttgacatatggttccagtctcatcagattttc
catgtcctggtggtggcagcggctttcgtccacttctatggggtgtccaacctacaggaa
ttccgttacggcctagagggtggatgtaccgatgactcccttctctga

KEGG   Rattus norvegicus (rat): 312670
Entry
312670            CDS       T01003                                 
Symbol
Adipor2
Name
(RefSeq) adiponectin receptor protein 2
  KO
K07297  adiponectin receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04920  Adipocytokine signaling pathway
rno04932  Non-alcoholic fatty liver disease
rno04936  Alcoholic liver disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    312670 (Adipor2)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    312670 (Adipor2)
  09149 Aging
   04211 Longevity regulating pathway
    312670 (Adipor2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    312670 (Adipor2)
   04932 Non-alcoholic fatty liver disease
    312670 (Adipor2)
SSDB
Motif
Pfam: HlyIII
Other DBs
NCBI-GeneID: 312670
NCBI-ProteinID: NP_001033068
RGD: 1307891
Ensembl: ENSRNOG00000007990
UniProt: Q3YAF7
LinkDB
Position
4:complement(152524604..152588848)
AA seq 386 aa
MNEPTEHRLGCTRTPEPDIRLRKGHQLDDTRGGNNDNHHGDLEPSLETPVCSSYYENSPE
ELECHDDNSQEDEGFMGMSPLLQAHHAMERMEEFVCKVWEGRWRVIPHDVLPDWLKDNDF
LLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQE
KVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFY
CNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFVGLGLSGIIPTLHYVISE
GFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHFHQLFHIFVVAGAF
VHFHGVSNLQEFRFMIGGGCTEEDAL
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgaacgagccaaccgaacaccgattggggtgcaccaggactccagagccagatataagg
ctcagaaaagggcaccaacttgatgatacaaggggaggtaacaatgacaaccaccacgga
gatttggagcccagtttagagacacctgtttgttcttcctactatgaaaatagccccgag
gaactcgagtgtcatgatgacaactcccaagaagatgaagggtttatgggcatgtcccct
ctcctacaagcccatcatgctatggaacgaatggaagagtttgtttgtaaggtgtgggaa
ggtcgatggcgagtgatccctcatgatgtgctgccagattggcttaaggacaatgacttc
cttctccatggacaccggcctcctatgccttctttccgggcctgttttaagagcatcttt
agaatacacacagagacgggcaacatttggacacatctcctaggttgtgtattcttcctg
tgcctggggatcttttatatgtttcgcccaaatatatcttttgtggcccctctgcaagag
aaagtggtcttcgggttgttcttcttgggagccattctctgcctttccttttcatggctc
ttccacacggtgtactgccactcagaaggggtctcccgactcttctctaaattggattac
tctggtattgctcttctgatcatgggaagttttgttccttggctttattattctttctac
tgtaacccacaaccttgcttcatctacctgattgtcatctgtgtgctgggcattgcagcc
attatcgtctctcagtgggacatgtttgccacccctcagtatcggggggtcagagcagga
gtgttcgtgggcttgggtctgagtggaatcatccctaccttgcattatgtcatctcagaa
gggttcctgaaggctgccaccatagggcagataggctggctaatgctcatggctagcctc
tatatcacaggagctgccctctacgcggcccgtatccctgagcgcttctttcctggcaaa
tgtgacatctggtttcactttcatcagctcttccacatctttgtggttgctggtgccttt
gttcacttccatggagtctcaaacctgcaggaatttcgtttcatgattggtgggggctgc
actgaagaggatgcgctgtga

DBGET integrated database retrieval system