KEGG   Rattus norvegicus (rat): 291450
Entry
291450            CDS       T01003                                 

Gene name
Aldh7a1
Definition
(RefSeq) alpha-aminoadipic semialdehyde dehydrogenase
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00053  Ascorbate and aldarate metabolism
rno00071  Fatty acid degradation
rno00260  Glycine, serine and threonine metabolism
rno00280  Valine, leucine and isoleucine degradation
rno00310  Lysine degradation
rno00330  Arginine and proline metabolism
rno00340  Histidine metabolism
rno00380  Tryptophan metabolism
rno00410  beta-Alanine metabolism
rno00561  Glycerolipid metabolism
rno00620  Pyruvate metabolism
rno01100  Metabolic pathways
Module
rno_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
rno_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
rno_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    291450 (Aldh7a1)
   00053 Ascorbate and aldarate metabolism
    291450 (Aldh7a1)
   00620 Pyruvate metabolism
    291450 (Aldh7a1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    291450 (Aldh7a1)
   00561 Glycerolipid metabolism
    291450 (Aldh7a1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    291450 (Aldh7a1)
   00280 Valine, leucine and isoleucine degradation
    291450 (Aldh7a1)
   00310 Lysine degradation
    291450 (Aldh7a1)
   00330 Arginine and proline metabolism
    291450 (Aldh7a1)
   00340 Histidine metabolism
    291450 (Aldh7a1)
   00380 Tryptophan metabolism
    291450 (Aldh7a1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    291450 (Aldh7a1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     291450 (Aldh7a1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     291450 (Aldh7a1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     291450 (Aldh7a1)
SSDB
Motif
Pfam: Aldedh DUF1487
Other DBs
NCBI-GeneID: 291450
NCBI-ProteinID: NP_001258034
RGD: 1308614
Ensembl: ENSRNOG00000014645
UniProt: Q64057
LinkDB
Position
18
AA seq 539 aa
MLRLARPLCVQTVKASKLSRLWSRPAALMSTLLIHHPQYAWLQDLGLREDNEGVFNGSWG
GRGEVITTYCPANNEPIARVRQASMKDYEETIGKAKKAWNIWADIPAPKRGEIVRKIGDA
LREKIQLLGRLVSLEMGKILVEGIGEVQEYVDVCDYAAGLSRMIGGPTLPSERPGHALME
QWNPLGLVGIITAFNFPVAVFGWNNAIALITGNVCLWKGAPTTSLVSIAVTKIIAKVLED
NLLPGAICSLTCGGADMGTAMARDERVNLLSFTGSTQVGKQVALMVQERFGKSLLELGGN
NAIIAFEDADLSLVLPSALFAAVGTAGQRCTTVRRLFLHESIHDEVVDRLKNAYSQIRVG
NPWDPNILYGPLHTKQAVSMFVQAVEEAKKEGGTVVYGGKVMDHPGNYVEPTIVTGLVHD
APIVHKETFAPILYVFKFKNEEEVFEWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGI
VNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSTALPLAQGIKFQ
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgttgcgtctggctcgcccgctctgcgtgcagactgtgaaggccagcaaactttcccgc
ctttggagtaggcctgccgcccttatgtctactctgctgatccatcatccccagtatgcc
tggctgcaagacctgggtctccgcgaagataacgagggcgtgtttaatggaagctggggc
ggccggggagaggtaattacgacctattgtcctgctaacaatgagccaatagcaagagtc
cgacaggccagcatgaaagactatgaagagactatagggaaagccaagaaagcttggaac
atctgggcagatattcctgccccaaagcgaggagaaatagtcagaaagattggcgatgcc
ttgcgggagaagatccaattactgggaagactggtgtctttggagatggggaaaatctta
gtggaaggaataggggaggttcaggagtacgtggacgtctgcgattatgctgccggcttg
tcgaggatgatcgggggacccaccttgccctctgaaagacccggccatgctctcatggaa
cagtggaatccgttaggcctggtgggaatcatcactgccttcaacttccctgtggctgtg
tttggctggaacaatgccatagctctgatcacaggcaacgtctgcctttggaaaggagca
ccaacaacttccctcgttagtatagctgtcacaaagatcatagccaaggttttggaggac
aacctgctgcctggtgccatttgctccctgacctgtggtggagcagatatgggcacagca
atggccagagatgagcgtgtgaacctgctgtcgttcactgggagcactcaggtggggaag
caggtggccctcatggtgcaggagaggtttgggaaaagcttgttggagctcggaggaaac
aatgccatcattgctttcgaggacgccgacctcagcttggttcttccctccgctctgttt
gccgccgtgggaacagccggccagaggtgtaccactgtgaggcgactgtttttgcacgaa
agcatccatgatgaagttgtagacagactgaaaaatgcctactcacagatccgtgtcggg
aacccctgggaccccaatatcctctatggaccgctccacaccaaacaggcggtgagcatg
tttgtgcaagccgtggaagaagcaaagaaagaaggaggcacggtggtctatgggggcaag
gtcatggaccaccctggcaattatgtggaacccaccattgtgactggtcttgtccatgat
gcgcccattgttcacaaggagacttttgccccaattctctatgtcttcaaattcaagaat
gaagaagaggtctttgaatggaacaatgaagtaaaacagggactttcgagtagtatcttt
accaaggatctgggcagaatcttccgctggcttggacctaagggttcagactgtggcatt
gtgaacgtcaatattcctaccagcggggctgagatcggcggtgcgtttggaggcgagaag
cacacgggcggtggcagggaatctggcagcgatgcctggaagcagtacatgcggagatct
acgtgtaccatcaactacagcacggccctccctctggctcaaggtatcaagtttcagtga

KEGG   Rattus norvegicus (rat): 29539
Entry
29539             CDS       T01003                                 

Gene name
Aldh2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial precursor
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00053  Ascorbate and aldarate metabolism
rno00071  Fatty acid degradation
rno00280  Valine, leucine and isoleucine degradation
rno00310  Lysine degradation
rno00330  Arginine and proline metabolism
rno00340  Histidine metabolism
rno00380  Tryptophan metabolism
rno00410  beta-Alanine metabolism
rno00561  Glycerolipid metabolism
rno00620  Pyruvate metabolism
rno00770  Pantothenate and CoA biosynthesis
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
Module
rno_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    29539 (Aldh2)
   00053 Ascorbate and aldarate metabolism
    29539 (Aldh2)
   00620 Pyruvate metabolism
    29539 (Aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    29539 (Aldh2)
   00561 Glycerolipid metabolism
    29539 (Aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    29539 (Aldh2)
   00310 Lysine degradation
    29539 (Aldh2)
   00330 Arginine and proline metabolism
    29539 (Aldh2)
   00340 Histidine metabolism
    29539 (Aldh2)
   00380 Tryptophan metabolism
    29539 (Aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    29539 (Aldh2)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    29539 (Aldh2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     29539 (Aldh2)
SSDB
Motif
Pfam: Aldedh DUF1235
Other DBs
NCBI-GeneID: 29539
NCBI-ProteinID: NP_115792
RGD: 69219
Ensembl: ENSRNOG00000001344
UniProt: P11884
LinkDB
Position
12
AA seq 519 aa
MLRAALSTARRGPRLSRLLSAAATSAVPAPNQQPEVFCNQIFINNEWHDAVSKKTFPTVN
PSTGEVICQVAEGNKEDVDKAVKAARAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTY
LAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGV
CGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIV
PGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGSSNLKRVTLELGGKSPNIIMSDA
DMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYDEFVERSVARAKSRVVGNPFDSRTEQ
GPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMTIAKEEIF
GPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYDVFGA
QSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
NT seq 1560 nt   +upstreamnt  +downstreamnt
atgctgcgcgccgcactcagcaccgcccgccgtgggccacgcctgagccgcctgctgtcc
gccgccgccaccagcgcggtgccagcccccaaccagcagcccgaggtcttctgcaaccag
atcttcattaacaatgagtggcatgatgctgtcagcaagaaaacattccccaccgtcaac
ccttccacgggggaggtcatctgccaggtagccgaagggaacaaggaggacgtagacaag
gcagtgaaggccgctcgggcagccttccagctgggctcgccctggcgccgcatggatgca
tctgacaggggccggctgttgtaccgattggctgatctcatcgaacgggaccggacctac
ctggcggccttggagaccctggacaacggcaagccttatgtcatctcctacctggtggat
ttggacatggttctgaaatgtctccgctattatgctggctgggctgacaagtaccacggg
aaaaccattcccatcgatggcgacttcttcagctacacccgccacgagcctgtgggcgtg
tgtggacagatcattccgtggaacttcccgctcctgatgcaagcctggaagctgggccct
gccttggcaactggaaacgtggtggtgatgaaagtggccgagcagacaccgctcactgca
ctctacgtggccaacttgatcaaggaggcaggcttcccccctggtgtggtcaatattgtt
cctggattcggccctaccgccggggctgccatcgcgtcccacgaggatgtggacaaagtg
gccttcacaggttccactgaggttggtcacctaatccaggttgccgccgggagcagcaat
ctcaagagagtaaccctggaactggggggaaagagccccaatatcatcatgtcagacgct
gacatggactgggctgtggaacaggcccactttgccctgttcttcaaccagggccagtgc
tgttgtgcgggctcccggaccttcgtgcaggaggatgtgtatgatgaattcgtggaacgc
agtgtggcccgggccaagtctcgggtggtcgggaaccctttcgacagccggacggagcag
gggccgcaggtggatgagactcagtttaagaagatcctgggctatatcaagtcaggacaa
caagaaggggcgaagctgctgtgcggtgggggcgccgccgcagaccgtggttacttcatc
cagcccaccgtgttcggagacgtcaaagatggcatgaccatcgccaaggaggagatcttc
ggaccagtgatgcagatcctcaaattcaagaccattgaggaggttgtggggcgagccaat
aattccaagtacgggctggctgccgctgtcttcacaaaggacctggacaaggccaattac
ctgtcccaagctctgcaggctgggactgtgtggatcaactgctacgatgtgtttggggcc
cagtccccatttggtggctataagatgtcggggagtggcagggagctgggcgagtatggc
ctgcaggcctacacggaagtgaagacggtcaccgtcaaagtgccacagaagaactcgtaa

KEGG   Rattus norvegicus (rat): 298079
Entry
298079            CDS       T01003                                 

Gene name
Aldh1b1
Definition
(RefSeq) aldehyde dehydrogenase X, mitochondrial precursor
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00053  Ascorbate and aldarate metabolism
rno00071  Fatty acid degradation
rno00280  Valine, leucine and isoleucine degradation
rno00310  Lysine degradation
rno00330  Arginine and proline metabolism
rno00340  Histidine metabolism
rno00380  Tryptophan metabolism
rno00410  beta-Alanine metabolism
rno00561  Glycerolipid metabolism
rno00620  Pyruvate metabolism
rno00770  Pantothenate and CoA biosynthesis
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
Module
rno_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    298079 (Aldh1b1)
   00053 Ascorbate and aldarate metabolism
    298079 (Aldh1b1)
   00620 Pyruvate metabolism
    298079 (Aldh1b1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    298079 (Aldh1b1)
   00561 Glycerolipid metabolism
    298079 (Aldh1b1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    298079 (Aldh1b1)
   00310 Lysine degradation
    298079 (Aldh1b1)
   00330 Arginine and proline metabolism
    298079 (Aldh1b1)
   00340 Histidine metabolism
    298079 (Aldh1b1)
   00380 Tryptophan metabolism
    298079 (Aldh1b1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    298079 (Aldh1b1)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    298079 (Aldh1b1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     298079 (Aldh1b1)
SSDB
Motif
Pfam: Aldedh SSV1_ORF_D-335
Other DBs
NCBI-GeneID: 298079
NCBI-ProteinID: NP_001011975
RGD: 1306737
Ensembl: ENSRNOG00000011497
UniProt: Q66HF8
LinkDB
Position
5
AA seq 519 aa
MLNARFLVPRLLCLQGRTTSYSTAAALPNPIPNPEIRYNQLFINNEWHDAVSKKTFPTVN
PTTGEVIGHVAEGDRADVDLAVRAAREAFRLGSPWRRMDASERGRLLNRLADLVERDRVY
LASLETLDNGKPFQESYVLDLDEVIKVYRYLAGWADKWHGKTIPMDGEHFCFTRHEPVGV
CGQIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNII
TGYGPTAGAAIAQHMDVDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADA
DMDHAVDQCHEALFFNMGQCCCAGSRTFVEESIYHEFLERTVEKAKKRKVGNPFELDTQQ
GPQVDKEQFEKILGYIRLGQKEGAKLLCGGERFGERGFFIKPTVFGNVQDDMRIAREEIF
GPVQPLFKFKKIEEVIQRANNTRYGLAAAVFTRDLDKALYFSQALQAGTVWVNTYNIVTC
HTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVSEKNS
NT seq 1560 nt   +upstreamnt  +downstreamnt
atgctgaacgcccgattcttggtgccccggctcctctgcctccagggcaggaccacctca
tattctacagcggctgctctcccaaacccaatcccaaacccagagattcgctacaaccag
ctgttcatcaacaacgagtggcatgatgcggtcagcaaaaagaccttccccacggtgaac
cccacgacaggcgaggtcattgggcatgtggctgaaggtgaccgggcagatgtggatctg
gctgtgagagcagcccgagaagccttccgcctggggtccccgtggcgcaggatggatgcc
tcagagcggggccggctgctgaaccgcctagctgatctcgtggaacgggatcgagtgtac
ttggcctcactggagaccctggataatgggaaaccttttcaggagtcttatgtcttggac
ctggatgaagtcatcaaggtataccgttaccttgctggctgggctgacaaatggcatggt
aagaccatcccaatggacggcgaacatttctgcttcacccgccatgagccagtgggtgtc
tgtggccagataatcccttggaacttcccattggtcatgcagggttggaagctggcccca
gcactcgccacaggcaacaccgtggtcatgaaggtggcagagcaaaccccactttctgct
ctgtacttggcctccctcatcaaggaagcggggtttcccccaggagtggtgaatatcatc
accggctacggccccactgcaggagcagccattgcccagcacatggatgtggataaagtc
gccttcaccggctctaccgaggtgggccacctgattcagaaggccgccggtgattccaac
ctcaagagagtcaccctggagctgggtgggaaaagccccagcatcgtgctggcagacgct
gacatggatcacgccgtagaccagtgtcacgaagccctctttttcaacatgggtcagtgc
tgctgtgcaggatcccggacattcgtggaagagtccatctatcatgagtttctcgagaga
actgtggagaaggccaagaagaggaaagtggggaacccctttgagttggacactcaacag
ggacctcaggtggacaaggagcaatttgaaaagatcctgggctacatccggcttggacag
aaggaaggggcaaagcttctctgtggtggggagcgtttcggggaacgcggcttcttcatc
aagcccacagtctttgggaatgttcaggatgacatgaggatcgccagggaggagatcttt
gggcctgtgcagcctctgttcaagttcaagaagatcgaggaagtaatccagagagccaac
aataccaggtacggcttggctgcggctgtattcacccgagacctggacaaggccttatac
ttttcccaggccctgcaagccgggaccgtgtgggtgaacacctacaatatcgtcacctgc
cacacgccattcggaggctttaaggaatccggcaatggcagagagctgggggaagatggg
cttaaagcctacacggaggtgaagactgtcaccatcaaggtttctgagaagaattcctga

KEGG   Rattus norvegicus (rat): 64040
Entry
64040             CDS       T01003                                 

Gene name
Aldh9a1
Definition
(RefSeq) 4-trimethylaminobutyraldehyde dehydrogenase
  KO
K00149  aldehyde dehydrogenase family 9 member A1 [EC:1.2.1.47 1.2.1.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00053  Ascorbate and aldarate metabolism
rno00071  Fatty acid degradation
rno00280  Valine, leucine and isoleucine degradation
rno00310  Lysine degradation
rno00330  Arginine and proline metabolism
rno00340  Histidine metabolism
rno00380  Tryptophan metabolism
rno00410  beta-Alanine metabolism
rno00561  Glycerolipid metabolism
rno00620  Pyruvate metabolism
rno01100  Metabolic pathways
Module
rno_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    64040 (Aldh9a1)
   00053 Ascorbate and aldarate metabolism
    64040 (Aldh9a1)
   00620 Pyruvate metabolism
    64040 (Aldh9a1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    64040 (Aldh9a1)
   00561 Glycerolipid metabolism
    64040 (Aldh9a1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    64040 (Aldh9a1)
   00310 Lysine degradation
    64040 (Aldh9a1)
   00330 Arginine and proline metabolism
    64040 (Aldh9a1)
   00340 Histidine metabolism
    64040 (Aldh9a1)
   00380 Tryptophan metabolism
    64040 (Aldh9a1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    64040 (Aldh9a1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     64040 (Aldh9a1)
    1.2.1.47  4-trimethylammoniobutyraldehyde dehydrogenase
     64040 (Aldh9a1)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 64040
NCBI-ProteinID: NP_071609
RGD: 68409
Ensembl: ENSRNOG00000004027
UniProt: Q9JLJ3 A0A0G2JSI1
LinkDB
Position
13
AA seq 497 aa
MSTGTFVVSQPLNYRGGARVEPVDASGTEKAFEPATGREIATFKCSGEKEVNLAVENAKA
AFKIWSKKSGLERCQVLLEAARIIKERRDEIAIMETINNGKSIFEARLDVDTSWQCLEYY
AGLAASMAGEHIQLPGGSFGYTRREPLGVCLGIGAWNYPFQIACWKSAPALACGNAMIFK
PSPFTPVSALLLAEIYTKAGAPNGLFNVVQGGAATGQFLCQHRDVAKVSFTGSVPTGMKI
MEMAAKGIKPITLELGGKSPLIIFSDCNMKNAVKGALLANFLTQGQVCCNGTRVFVQKEI
ADAFTKEVVRQTQRIKIGDPLLEDTRMGPLINAPHLERVLGFVRSAKEQGATVLCGGEPY
APEDPKLKHGYYMTPCILTNCTDDMTCVKEEIFGPVMSILTFETEAEVLERANDTTFGLA
AGVFTRDIQRAHRVAAELQAGTCYINNYNVSPVELPFGGYKKSGFGRENGRVTIEYYSQL
KTVCVEMGDVESPFENQ
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgagcactggcaccttcgtcgtgtcgcagccgctcaactaccgcggcggggcccgcgtg
gagccggtggatgcctccggcacggagaaagcgttcgagccagccaccggccgagagata
gctactttcaagtgttcgggagaaaaggaagtaaatttggctgttgaaaatgcaaaagct
gcctttaaaatctggagtaagaaaagcggcttggagcgttgtcaagtcctcttagaggct
gcccggataataaaggaacggagggatgaaattgccattatggagaccatcaacaacggg
aagtccatatttgaggctcgcctggatgttgacacttcctggcagtgcctggaatactat
gcaggcctggctgcgtccatggcgggagagcacatccagctcccaggagggtcctttggc
tacaccagaagagaaccacttggggtgtgtttggggataggagcatggaactaccccttc
cagattgcctgttggaagtctgctccggctttggcttgtggtaatgccatgatctttaag
ccctctcccttcacgcctgtgtctgctctgctcctggctgagatctacaccaaagccggt
gcgcctaacggcctcttcaacgtggtgcaaggtggggctgccacaggccagtttctgtgt
cagcatcgtgatgtggccaaagtctccttcactggaagcgtgcccactggcatgaagatc
atggagatggccgctaaaggaatcaaacccattactttggaacttgggggcaaatctcct
ctgatcattttctctgactgtaatatgaagaatgctgtgaagggggccttgctggccaac
ttcctcacacaaggacaggtgtgctgcaacggcactagagtgtttgtgcaaaaggaaatt
gctgacgcatttacaaaggaagttgtgaggcagactcagaggataaagattggggaccca
cttctggaagatacaaggatgggcccactcatcaatgccccgcacctggagcgagtcctc
gggtttgtcaggtctgcaaaggagcagggtgccactgtgctgtgtggtggagagccgtat
gccccggaggatcctaagttaaaacatggatattacatgacaccttgcattttaactaat
tgcacagatgacatgacttgtgtaaaagaagagatctttgggccagttatgtccattcta
acatttgagactgaagccgaggttctggagcgggccaatgacaccacgtttggactagca
gctggggtctttaccagggacattcagagggcgcacagggtggcggctgagctgcaggcc
ggaacgtgctacattaacaactataacgtcagcccggtggagttgccctttggtggatac
aagaagtcaggatttggcagagagaacggccgagtgacgattgagtactattcacagctg
aagacggtgtgtgtggagatgggggacgtggagtcgccttttgaaaaccagtga

KEGG   Rattus norvegicus (rat): 65183
Entry
65183             CDS       T01003                                 

Gene name
Aldh3a2
Definition
(RefSeq) aldehyde dehydrogenase family 3 member A2
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00053  Ascorbate and aldarate metabolism
rno00071  Fatty acid degradation
rno00280  Valine, leucine and isoleucine degradation
rno00310  Lysine degradation
rno00330  Arginine and proline metabolism
rno00340  Histidine metabolism
rno00380  Tryptophan metabolism
rno00410  beta-Alanine metabolism
rno00561  Glycerolipid metabolism
rno00620  Pyruvate metabolism
rno00770  Pantothenate and CoA biosynthesis
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
Module
rno_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    65183 (Aldh3a2)
   00053 Ascorbate and aldarate metabolism
    65183 (Aldh3a2)
   00620 Pyruvate metabolism
    65183 (Aldh3a2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    65183 (Aldh3a2)
   00561 Glycerolipid metabolism
    65183 (Aldh3a2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    65183 (Aldh3a2)
   00310 Lysine degradation
    65183 (Aldh3a2)
   00330 Arginine and proline metabolism
    65183 (Aldh3a2)
   00340 Histidine metabolism
    65183 (Aldh3a2)
   00380 Tryptophan metabolism
    65183 (Aldh3a2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    65183 (Aldh3a2)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    65183 (Aldh3a2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     65183 (Aldh3a2)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 65183
NCBI-ProteinID: NP_113919
RGD: 61866
Ensembl: ENSRNOG00000002342
UniProt: P30839 G3V9W6
LinkDB
Position
10
AA seq 484 aa
MERQVQRLRQTFRSGRSRPLRFRLQQLEALRRMVQEREKDILAAIAADLSKSELNAYSHE
VITILGEIDFMLGNLPELASARPAKKNLLTMMDEAYVQPEPLGVVLIIGAWNYPFVLTLQ
PLVGAIAAGNAAIVKPSELSENTAKILAELLPQYLDQDLYMIVNGGVEETTELLRQRFDH
ILYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDRDCDLDVACRRITWGKYMNCGQT
CIAPDYILCEASLQDQIVQKIKDTVKDFYGENVKASPDYERIINLRHFKRIKSLLEGQKI
AFGGETDEATRYIAPTILTDVDPNSKVMQEEIFGPILPIVSVKNVEEAINFINDREKPLA
LYIFSHNNKLIKRVIDETSSGGVTGNDVIMHFTVNSLPFGGVGASGMGAYHGKYSFDTFS
HQRPCLLKGLKGESVNKLRYPPNSESKVSWSKFFLLKQFNKGRLQLLLLVCLVAVAAVIV
KDQL
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggagcgacaggtccaacgacttcgccagacgttccggtccggccgatcgcggccgctg
cgtttccgactgcagcagctcgaggccctccggaggatggtgcaagagcgagagaaggac
atcttggcagccatcgcagcagacctgagcaaaagtgaactcaatgcatacagtcatgaa
gtcattaccatccttggggagattgacttcatgctggggaatcttcctgaattggcctct
gctcggccagcgaagaagaacctgcttaccatgatggacgaggcctatgttcagccagag
cctctgggagtcgtgctgattattggagcttggaactatccttttgttctgaccctgcag
ccactggtgggagccattgctgcaggaaatgctgccattgttaagccctcggaactcagt
gaaaacacggctaagatcttggctgaactcctccctcagtatttagaccaggacctgtac
atgattgttaatggcggcgttgaagaaaccacagagcttctgaggcagcggtttgatcac
attctctacacaggaaacaccgcagttggaaaaattgtcatggaggctgctgccaagcac
ctgacccctgtgaccctggagctcgggggcaaaagcccatgctacattgacagagactgt
gacctggacgttgcttgcagacggataacctggggaaagtacatgaattgtggtcagacc
tgtattgctcctgactatatcctgtgtgaagcctccctccaggatcaaatcgtacagaag
attaaggatacggtgaaggacttttatggggaaaatgtaaaagcttctcctgattatgaa
aggatcatcaaccttcgtcactttaagaggataaaaagtttgcttgaaggacagaaaata
gcttttggtggggagactgatgaagctacacgctacatagccccaaccatactcactgat
gttgaccctaactccaaggtgatgcaagaagaaatttttggaccaattctcccaatagtg
tctgtgaaaaatgtggaggaagccataaatttcataaatgatcgcgaaaagcccctggca
ctctacatattttctcacaacaataagctcatcaaacgggtgattgatgagacatccagt
ggtggagtcacaggcaatgatgtcatcatgcacttcactgttaattctttgccctttgga
ggtgtgggtgccagtggaatgggggcttatcatggcaaatacagtttcgataccttttct
catcagcgcccctgcttgttaaaagggttaaagggagagagtgttaacaaactcaggtac
cctcccaacagcgagtccaaggtcagctggtcgaaattcttcctgctgaaacagttcaac
aaaggaaggctgcagctgctgcttctcgtgtgcttggttgcggttgcagctgtgatcgtc
aaggatcagctgtga

DBGET integrated database retrieval system