KEGG   Rattus norvegicus (rat): 29535
Entry
29535             CDS       T01003                                 

Gene name
Pdx1
Definition
(RefSeq) pancreas/duodenum homeobox protein 1
  KO
K07594  insulin promoter factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04911  Insulin secretion
rno04930  Type II diabetes mellitus
rno04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    29535 (Pdx1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    29535 (Pdx1)
   04950 Maturity onset diabetes of the young
    29535 (Pdx1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    29535 (Pdx1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: HOXL
    29535 (Pdx1)
SSDB
Motif
Pfam: Homeodomain TMEM171
Other DBs
NCBI-GeneID: 29535
NCBI-ProteinID: NP_074043
RGD: 62387
Ensembl: ENSRNOG00000046458
UniProt: P52947
LinkDB
Position
12
AA seq 283 aa
MNSEEQYYAATQLYKDPCAFQRGPVPEFSANPPACLYMGRQPPPPPPPQFAGSLGTLEQG
SPPDISPYEVPPLADDPAGAHLHHHLPAQLGLAHPPPGPFPNGTETGGLEEPSRVHLPFP
WMKSTKAHAWKSQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELA
VMLNLTERHIKIWFQNRRMKWKKEEDKKRSSGTTSGGGGGEEPEQDCAVTSGEELLALPP
PPPPGGAVPSGVPAAAREGRLPSGLSASPQPSSIAPLRPQEPR
NT seq 852 nt   +upstreamnt  +downstreamnt
atgaatagtgaggagcagtactacgcggccacacagctctacaaggacccgtgcgcattc
cagaggggtccggtgccagagttcagtgctaatccccctgcgtgcctgtacatgggccgc
cagcccccacctccgccgccaccccagtttgcaggctcgctgggaacgctggaacaggga
agtcccccggacatctccccatacgaagtgcccccgctcgccgatgacccggctggcgcg
cacctccaccaccacctcccagctcagctcgggctcgcccatccacctcccggacctttc
ccgaatggaaccgagactgggggcctggaagagcccagccgcgttcatctccctttcccg
tggatgaaatccaccaaagctcacgcgtggaaaagccagtgggcaggaggtgcatacgca
gcagaaccggaggagaataagaggacccgtacagcctacactcgggcccagctgctggag
ctggagaaggaattcttatttaacaaatacatctcccggcctcgccgggtggagctggca
gtgatgctcaacttgactgagagacacatcaaaatctggttccaaaaccgtcgcatgaag
tggaagaaagaggaagataagaaacgtagtagcgggacaacgagcgggggcggtgggggc
gaagagccggagcaggattgtgccgtaacctcgggcgaggagctgctggcattgccaccg
ccaccacctcccggaggtgctgtgccctcaggcgtccctgctgctgcccgggagggccga
ctgccttccggccttagtgcgtccccacagccctccagcatcgcgccactgcgaccgcag
gaaccccggtga

DBGET integrated database retrieval system