KEGG   Rattus norvegicus (rat): 296259
Entry
296259            CDS       T01003                                 

Gene name
Acss1
Definition
(RefSeq) acetyl-coenzyme A synthetase 2-like, mitochondrial
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00620  Pyruvate metabolism
rno00630  Glyoxylate and dicarboxylate metabolism
rno00640  Propanoate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    296259 (Acss1)
   00620 Pyruvate metabolism
    296259 (Acss1)
   00630 Glyoxylate and dicarboxylate metabolism
    296259 (Acss1)
   00640 Propanoate metabolism
    296259 (Acss1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rno01004]
    296259 (Acss1)
Enzymes [BR:rno01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     296259 (Acss1)
Lipid biosynthesis proteins [BR:rno01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   296259 (Acss1)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Other DBs
NCBI-GeneID: 296259
NCBI-ProteinID: NP_001099994
RGD: 1306246
Ensembl: ENSRNOG00000007102
UniProt: D3ZZN3
LinkDB
Position
3
AA seq 682 aa
MAARSLGSGVGRLLRGLHGHSGQSGWLLSLSRWTTTRFLGSVPAAAQLGSYPALSAQAAQ
EPAAFWGPLARDTLVWDTPYHTVWDCDFRTGKIGWFLGGQLNVSVNCLDQHVQKSPDTIA
LIWERDEPGTEVRITYRELLETTCRLANTLKRHGVHRGDRVAIYMPVSPLAVAAMLACAR
IGAIHTVVFAGFSAESLAGRINDAKCKVVITFNQGLRGGRVVELKKIVDEAVKNCPTVQH
VLVAHRTDTKVPMGNLDIPLEQEMANEAPVCTPESMNSEDMLFMLYTSGSTGTPKGLVHT
QAGYLLYAAMTHKLVFDYHPGDVFGCVADIGWITGHSYVVYGPLCNGATTVLFESTPVYP
DAGRYWETVQRLKINQFYGAPTAVRLLLKFGDAWVKKYDRSSLRTLGSVGEPINHEAWEW
LHKVVGDGRCTLVDTWWQTETGGICIAPRPSEDGAEILPGMAMRPFFGIVPALMDEKGNV
VEGGDVSGALCISQAWPGMARTIYGDHQRFVDAYFRTYPGYYFTGDGAHRTEGGYYQITG
RMDDVINISGHRLGTAEIEDAMADHPAVPETAVIGYPHDIKGEAAFAFIVLKDDVRDANV
VVNELKLAVATKIAKYAVPDQILVVKRLPKTRSGKVMRRLLRKIITSRGQDLGDTTTLED
PSVITEIMSAFREYEEQRAATN
NT seq 2049 nt   +upstreamnt  +downstreamnt
atggcggcgcgcagcctcggcagcggtgtggggcgactgctgcgtggcctgcacgggcac
tcgggacaatcggggtggttgctgagcctgtcccgctggaccaccacccgattcctgggc
agtgttcctgcagcagcgcagctaggctcgtaccccgctttgagcgctcaggcagcccag
gagccggccgccttctggggaccgctggcccgtgacacactagtttgggacactccttac
catactgtctgggactgcgacttcaggacgggcaagatcggctggttcctgggaggccag
ttgaatgtgtctgtcaactgcctggaccagcacgtgcagaagtctcccgacaccatagct
ttgatttgggagagagatgaacctgggacagaagtgaggatcacttacagggagcttctg
gagaccacatgccgcctggccaacacgctgaagaggcatggtgtgcaccgaggggaccgt
gtggccatctacatgcctgtgtccccactggctgtggcagcgatgctggcctgtgccagg
attggagctatccacacagtggtttttgctggctttagtgcagagtccttggccgggagg
atcaatgatgccaagtgcaaggttgttatcaccttcaaccaaggactccggggagggcgt
gtggtggagctgaagaaaatagtggacgaagctgtgaagaactgcccaacagtgcagcat
gtcctagtggctcacaggacggacaccaaggttcccatggggaatctggacatccccctt
gagcaggagatggccaatgaggcccctgtgtgtacccctgaaagcatgaacagtgaagat
atgctcttcatgctctacacgtctgggagcactgggacacccaagggactcgttcataca
caggcaggctatctgctgtatgccgccatgacgcacaagctcgtgtttgactaccatcca
ggtgatgtctttggttgtgtggctgacatcggttggatcacaggacacagctatgtggtg
tatggacccctctgcaatggagctaccacggtcctttttgagagcaccccagtttaccct
gatgctggtcgttactgggagacagtacagaggctaaagatcaaccagttctatggtgcc
ccgacagctgtccgactgctgctgaagttcggggatgcctgggtgaaaaagtatgaccgc
tcctccctgcgcacactggggtcagtgggagagcccatcaatcatgaggcctgggagtgg
ctccacaaagtggtgggtgatggcagatgtaccctggtggacacttggtggcagacagaa
actggaggcatctgcattgcaccacggccctcggaagatggggcagagatcctcccaggc
atggccatgaggccgttttttggcattgtccctgcactcatggatgagaagggcaatgtt
gtggagggtggtgatgtctctggggccctgtgtatttcccaagcttggccaggcatggca
aggaccatctacggtgaccaccagaggttcgtagatgcctacttcagaacgtacccaggt
tactacttcactggagatggagctcaccggacggagggtggctattaccagatcacaggg
cgcatggatgatgtcatcaacatcagtggtcatcgcctggggactgcagagattgaggat
gcaatggctgaccatcccgctgtcccagaaactgctgtcattgggtaccctcatgacatc
aaaggagaagctgcgtttgccttcattgtactgaaagatgacgtccgtgatgcaaacgtg
gtggtaaatgagctcaagttggcagtggccaccaagatcgccaagtatgctgtgcctgac
cagatcctggtggtgaagcgtctccccaaaaccaggtctgggaaggtgatgaggaggctg
ctgaggaagatcatcaccagcagggggcaggatctaggggacaccactaccctggaggac
cccagtgtcatcacggagatcatgagtgcctttcgggagtacgaagagcagcgggctgcc
accaactga

KEGG   Rattus norvegicus (rat): 311569
Entry
311569            CDS       T01003                                 

Gene name
Acss2
Definition
(RefSeq) acetyl-coenzyme A synthetase, cytoplasmic
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00620  Pyruvate metabolism
rno00630  Glyoxylate and dicarboxylate metabolism
rno00640  Propanoate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    311569 (Acss2)
   00620 Pyruvate metabolism
    311569 (Acss2)
   00630 Glyoxylate and dicarboxylate metabolism
    311569 (Acss2)
   00640 Propanoate metabolism
    311569 (Acss2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rno01004]
    311569 (Acss2)
Enzymes [BR:rno01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     311569 (Acss2)
Lipid biosynthesis proteins [BR:rno01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   311569 (Acss2)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Other DBs
NCBI-GeneID: 311569
NCBI-ProteinID: NP_001101263
RGD: 1305489
Ensembl: ENSRNOG00000018755
UniProt: G3V9U0
LinkDB
Position
3
AA seq 701 aa
MGLPEERRKSGSGSRAREETGAEGRVRGWSPPPEVRRSAHVPSLQRYRELHRRSVEEPRE
FWGNIAKEFYWKTPCPGPFLQYNFDVTKGKIFTEWMKGATTNICYNVLDRNVHEKKLGDK
VAFYWEGNEPGETTKITYRELLVQVCQFSNVLRKQGVQKGDRVAIYMPMILELVVAMLAC
ARLGALHSIVFAGFSAESLCERILDSSCCLLITTDAFYRGEKLVNLKELADESLEKCREK
GFPVRCCIVVKHLGRAELGMNDSPSQSPPVKRPCPDVQISWNEGVDLWWHELMQQAGDEF
EPEWCDAEDPLFILYTSGSTGKPKGVVHTVGGYMLYVATTFKYVFDFHPEDVFWCTADIG
WITGHSYVTYGPLANGATSVLFEGIPTYPDEGRLWSIVDKYKVTKFYTAPTAIRMLMKFG
DDPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGSQRCPIVDTFWQTETGGHMLTPLPG
ATPMKPGSASFPFFGVAPAILNESGEELEGEAEGYLVFKQPWPGIMRTVYGNHTRFETTY
FKKFPGYYVTGDGCRRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVV
GHPHPVKGECLYCFVTLCDGHTFSPTLTEELKKQIREKIGPIATPDYIQNAPGLPKTRSG
KIMRRVLRKIAQNDHDLGDTSTVADPSVINHLFSHRCLTTQ
NT seq 2106 nt   +upstreamnt  +downstreamnt
atggggcttcccgaggagcggcgcaagagcggcagcgggagccgggctcgcgaggagacc
ggcgccgagggccgggtgcggggttggtccccgccgccggaggtcagacgctcggcgcac
gtcccctctctgcagcgctaccgcgagctgcaccggcgttctgtggaggagccacgggag
ttttggggaaacattgccaaggaattttactggaaaaccccatgccctggcccattcctc
cagtacaactttgatgtgactaaagggaaaatattcactgagtggatgaaaggagcaacc
acaaacatctgctacaatgtgctggatagaaatgtccatgagaaaaaacttggcgacaaa
gttgctttttactgggagggcaatgagccaggggagaccaccaagatcacataccgtgaa
ctcctggtccaggtgtgtcagttcagcaatgttctccgtaaacagggtgttcagaagggt
gaccgagtggccatctacatgcctatgatcttggagcttgtggtggctatgctggcatgt
gctcgccttggagctttgcactccattgtgtttgcaggcttctctgcagagtctctctgt
gaacggatcttggattccagctgctgcctgctcattactacagatgccttctacaggggg
gaaaaacttgtgaacctgaaggagctggctgatgagtccttggagaagtgccgagagaag
ggtttcccagtgagatgctgcattgtggtcaaacatctggggcgggcagagctgggcatg
aatgactcccccagccagtccccacccgttaagaggccatgtccagatgtccagatctcc
tggaatgaaggggttgacttgtggtggcatgaactcatgcagcaggcaggagatgagttt
gagcctgagtggtgtgatgccgaggaccctctcttcatcttgtataccagtggctccaca
ggcaaacccaagggtgtggtgcacacagttggaggctacatgctctatgtggctacaact
ttcaagtatgtgtttgatttccatccggaggatgtattctggtgcacagcagacattggc
tggatcactggtcattcctatgtcacctatgggccgctggcgaatggtgccaccagtgtt
ttgtttgaggggatccccacatacccagatgaaggccgcttgtggagcattgtggacaaa
tacaaggtgaccaagttctacacggcaccaacagcaatccggatgctcatgaagtttgga
gatgatcctgtcaccaagcatagccgggcatccttgcaggtgctgggcacagtaggtgaa
cccatcaaccctgaagcctggctatggtaccatcgggtagtaggttcccagcgttgcccc
attgtagacaccttctggcaaacagaaacaggtggccatatgctgacccctctccctggt
gccacacccatgaaaccaggttctgcttctttcccgttctttggtgttgcgcctgcaatc
ctgaacgagtcgggggaagaactggaaggggaagctgaaggttatctggtgttcaagcag
ccctggccagggatcatgcgcacagtttatgggaaccacacacgtttcgagaccacctac
tttaagaagttccctggctactacgtgactggagatggctgccgacgggatcaggacggc
tattactggatcactggcaggattgatgacatgctcaatgtgtctggacatcttctgagt
acagcagaggtggaatcagcacttgtggaacatgaggctgttgcagaggcagctgtggtg
ggccaccctcatcctgtgaagggtgaatgcctctactgctttgttaccttgtgtgacggc
cataccttcagccccaccctcactgaggaactcaagaagcagattagagaaaagattggc
cccattgccacaccagactacatccagaatgcacccggcttgcctaaaacacgctcagga
aaaatcatgaggagagtactccggaagattgctcagaatgaccacgacctgggggatacc
tctacagtggctgacccatctgtcatcaaccatctcttcagtcaccgctgcctgaccaca
cagtga

DBGET integrated database retrieval system