KEGG   Rattus norvegicus (rat): 29650
Entry
29650             CDS       T01003                                 
Symbol
Adam10
Name
(RefSeq) disintegrin and metalloproteinase domain-containing protein 10 precursor
  KO
K06704  disintegrin and metalloproteinase domain-containing protein 10 [EC:3.4.24.81]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29650 (Adam10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    29650 (Adam10)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    29650 (Adam10)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.81  ADAM10 endopeptidase
     29650 (Adam10)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   29650 (Adam10)
CD molecules [BR:rno04090]
 Proteins
  29650 (Adam10)
SSDB
Motif
Pfam: Reprolysin_2 Reprolysin_5 Reprolysin_3 Reprolysin_4 Disintegrin Pep_M12B_propep Reprolysin Peptidase_M66
Other DBs
NCBI-GeneID: 29650
NCBI-ProteinID: NP_062127
RGD: 2032
Ensembl: ENSRNOG00000054257
UniProt: Q10743
LinkDB
Position
8:71346008..71477889
AA seq 749 aa
MVLPTVLILLLSWAAGLGGQYGNPLNKYIRHYEGLSYNVDSLHQKHQRAKRAVSHEDQFL
LLDFHAHGRQFNLRMKRDTSLFSDEFKVETSNKVLDYDTSHIYTGHIYGEEGSFSHGSVV
DGRFEGFIQTRGGTFYIEPAERYIKDRILPFHSVIYHEDDINYPHKYGPQGGCADHSVFE
RMRKYQMTGVEEGTRAHSEEHAASMGPELLRKKRTTLAERNTCQLYIQTDHLFFKYYGTR
EAVIAQISSHVKAIDTIYQTTDFSGIRNISFMVKRIRINTTSDEKDPTNPFRFPNIGVEK
FLELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKSLN
TGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYA
RATSGDKLNNNKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQC
KDECCFDANQPEGKKCKLKPGKQCSPSQGPCCTAQCAFKSKSEKCRDDSDCAKEGICNGF
TALCPASDPKPNFTDCNRHTQVCINGQCAGSICEKYDLEECTCASSDGKDDKELCHVCCM
KKMAPSTCASTGSLQWNKQFNGRTITLQPGSPCNDFRGYCDVFMRCRLVDADGPLARLKK
AIFSPQLYENIAEWIVAHWWAVLLMGIALIMLMAGFIKICSVHTPSSNPKLPPPKPLPGT
LKRRRPPQPIQQPPRQRPRESYQMGHMRR
NT seq 2250 nt   +upstreamnt  +downstreamnt
atggtgttgccgacagtgttaattctgctcctctcctgggcggcggggctgggaggtcag
tatggaaatcctttaaataaatatattagacattatgaaggattatcttacaatgtggat
tcattacaccaaaaacaccagcgtgccaaacgagcagtctcacacgaggaccagttttta
cttctagatttccatgctcatggaagacaattcaacctacgaatgaagagggacacttcc
ctttttagtgatgaatttaaagtagaaacgtcaaataaagtacttgattatgatacctct
catatttacactggacatatttatggtgaagaaggaagctttagtcatgggtctgtcgtt
gatggaagatttgaaggtttcatccagactcggggtggcacattttatattgagccagca
gagagatatattaaagaccgaatcctgccgtttcactctgtcatttatcatgaagatgat
attaactatccccataaatacggcccacaggggggctgtgcagatcactccgtctttgaa
aggatgaggaaataccaaatgactggagtagaggaaggaactcgggcacattcagaggag
catgctgctagtatgggtcctgagctcctgaggaaaaagcgcacaactctggctgagaga
aatacttgtcagctctatatccagacagatcacctgttctttaaatactatggaacacga
gaagctgtgattgctcagatatccagtcatgttaaagcaattgatacaatttaccagact
acagacttctccggaatccgtaacatcagctttatggtgaaacgcataagaatcaataca
acatctgatgaaaaagatcctacaaatcctttccgtttcccaaatattggtgtggagaag
ttcctggagttgaattctgagcagaatcatgatgactactgcttggcctatgtcttcacg
gaccgggattttgatgatggtgttcttggtctggcatgggttggagcaccttcaggaagc
tctggaggaatatgtgagaaaagcaagttgtattcagatggcaagaagaagtcattgaac
acgggcatcattactgttcagaactatggctctcacgtgcctcccaaagtctctcatatt
acttttgctcatgaagttggacataactttggatctccacatgattctggaacagagtgc
actccaggagagtctaagaacttaggacaaaaagaaaatggcaattacatcatgtatgcg
agagcaacgtctggggacaaacttaacaacaacaaattttcactctgcagcattaggaac
ataagccaagtgcttgagaagaagaggaacaactgttttgttgaatctggccagcctatc
tgtggaaatgggatggtggagcaaggggaagagtgtgactgtggctacagtgaccaatgc
aaagatgagtgctgcttcgatgcaaaccagccagaggggaagaaatgcaagctgaagcct
gggaagcagtgcagtccaagtcaaggaccctgctgtacagcacagtgtgcattcaagtca
aagtctgagaaatgtcgggatgattctgactgtgcaaaggaagggatatgcaatggcttc
acagccctttgcccagcatctgatcccaagcccaactttacagactgtaacaggcataca
caagtgtgcattaatgggcaatgtgcaggttctatctgtgagaagtatgacttggaggag
tgcacctgtgccagctctgatggcaaagatgataaggaattatgtcatgtttgctgcatg
aagaaaatggccccatcaacttgtgccagtacaggctctttgcagtggaacaagcagttc
aatggtcggactatcactctgcagccaggctctccatgtaatgacttcagaggctactgt
gatgttttcatgcggtgcagattagtagatgctgatggccctctagctaggctgaaaaaa
gcaatttttagtccacaactctatgaaaacattgctgagtggattgtggctcactggtgg
gcagtactgcttatgggaattgccctgatcatgctaatggctggatttatcaagatttgc
agtgttcacactccaagtagtaatccaaagttgcctcctcctaaaccacttccaggcact
ttaaagaggaggagaccgccacagcccattcagcagcccccgcgtcagaggccccgggag
agttatcaaatgggacacatgcgacgctga

KEGG   Rattus norvegicus (rat): 57027
Entry
57027             CDS       T01003                                 
Symbol
Adam17
Name
(RefSeq) disintegrin and metalloproteinase domain-containing protein 17 precursor
  KO
K06059  disintegrin and metalloproteinase domain-containing protein 17 [EC:3.4.24.86]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04330  Notch signaling pathway
rno05010  Alzheimer disease
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    57027 (Adam17)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    57027 (Adam17)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    57027 (Adam17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    57027 (Adam17)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    57027 (Adam17)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.86  ADAM 17 endopeptidase
     57027 (Adam17)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   57027 (Adam17)
CD molecules [BR:rno04090]
 Proteins
  57027 (Adam17)
SSDB
Motif
Pfam: Reprolysin_5 Reprolysin_2 ADAM17_MPD Disintegrin Reprolysin_3 Reprolysin Pep_M12B_propep Reprolysin_4
Other DBs
NCBI-GeneID: 57027
NCBI-ProteinID: NP_064702
RGD: 620404
Ensembl: ENSRNOG00000060694
UniProt: Q9Z1K9
LinkDB
Position
6:complement(40872936..40920700)
AA seq 827 aa
MRQRLLFLTTLVPFVLAPRPPEEPGSGSHLRLEKLDSLLSDYDILSLSNIQQHSIRKRDL
QSATHLETLLTFSALKRHFKLYLTSSTERFSQNLRVVVVDGKEESEYSVKWQDFFSGHVV
GEPDSRVLAHIGDDDVTVRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKDFSRLQS
PKVCGYLNADSEELLPKGLIDREPSEEFVRRVKRRAEPNPLKNTCKLLVVADHRFYKYMG
RGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGVQIEQIRILKSPQEVKPGERHFNM
AKSFPNEEKDAWDVKMLLEQFSLDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANS
HGGVCPKAYYNPGVKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGL
AECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKAQECFQERSNKVCGN
SRVDEGEECDPGIMYLNNDTCCNSDCTLKPGVQCSDRNSPCCKNCQFETAQKKCQEAINA
TCKGVSYCTGNSSECPPPGDAEDDTVCLDLGKCKAGKCIPFCKREQELESCACADTDNSC
KVCCRNLSGPCVPYVDAEQKNLFLRKGKPCTVGFCDMNGKCEKRVQDVIERFWDFIDQLS
INTFGKFLADNIVGSVLVFSLIFWIPFSILVHCVDKKLDKQYESLSLFHHSNIEMLSSMD
SASVRIIKPFPAPQTPGRLQALQPAAMMPPVSAAPKLDHQRMDTIQEDPSTDSHVDDDGF
EKDPFPNSSAAAKSFEDLTDHPVTRSEKAASFKLQRQSRVDSKETEC
NT seq 2484 nt   +upstreamnt  +downstreamnt
atgaggcagcgtctcctcttcctgaccactttggtgcctttcgtcctggcaccccgacct
ccggaggaaccaggctctggctcccacctgcgacttgagaagcttgattctttgctctca
gactacgatatcctctctttatctaatatccagcagcactccataaggaaaagggatcta
cagtctgcgacacacttagaaacactactaactttttcagctttgaaaaggcattttaaa
ttatacttgacatcaagtacagaacgcttttcacagaacttgcgagtcgtggtggtggat
gggaaagaggaaagcgagtacagtgtgaagtggcaggacttcttcagcggacatgtggtt
ggtgagcctgactctagggttctagcgcacataggagatgatgatgtcacagtaagaatc
aacacagatggggcagaatataacatagagccactttggaggtttgttaatgatactaaa
gataaaaggatgctggtgtataagtctgaagatatcaaggatttttcacgtttgcagtct
ccaaaagtatgtggttatttaaatgcagatagtgaagagttgcttccaaaagggctcata
gacagagagccatctgaagagtttgtccgtcgagtgaagaggcgagctgaacctaaccca
ttgaagaatacttgtaaattactggtggtggcagatcatcgattttataagtacatgggc
cgaggagaagagagcactactacaaattacttaatagagttaattgaccgagttgatgac
atataccggaacacctcgtgggacaatgcaggatttaaaggttatggagtacagatagaa
cagattcgaattctcaagtctccacaagaggtaaaacctggtgaaagacacttcaatatg
gcaaaaagttttccaaatgaagaaaaggatgcttgggatgtgaagatgctgctggagcaa
tttagccttgatatagctgaagaggcctctaaagtctgcctggctcatcttttcacctac
caagattttgatatgggaactcttggattagcttacgttggttctcccagagcaaacagt
catggaggggtttgtccaaaagcttattacaacccaggtgtgaagaagaacatctatttg
aatagtggtctgacaagtacaaaaaattatggtaaaaccatccttacaaaggaggctgac
ctggttacaactcatgaattgggacacaattttggagcagaacatgatcctgatgggctg
gcagagtgtgccccaaatgaggaccaaggaggaaagtatgttatgtaccccatagctgtg
agtggtgaccatgagaataataagatgttttcaaactgcagtaaacagtccatctacaag
accatagaaagcaaggctcaagagtgcttccaggagcgcagcaacaaggtgtgcggcaac
tccagggtggacgaaggagaagagtgtgacccgggcatcatgtacctgaacaacgacacc
tgctgcaatagtgactgcacactgaagccaggtgtgcagtgcagtgataggaatagtcct
tgctgtaaaaattgtcagtttgagacggcccagaagaagtgccaggaggctatcaatgct
acttgcaaaggagtgtcttactgcacagggaatagcagtgagtgccccccaccaggagat
gctgaagatgacactgtgtgcttggacctgggcaagtgcaaggctgggaaatgcatccct
ttctgcaagagggagcaggagctggagtcctgcgcatgtgctgacaccgacaactcgtgc
aaggtatgctgcaggaacctttctggcccatgtgtgccttacgtcgatgcagagcaaaag
aacttatttttgaggaaagggaagccctgtacagtagggttttgtgacatgaatggcaaa
tgtgagaaacgggtacaggacgtaattgagcggttttgggatttcattgaccagctgagc
atcaacacttttgggaagtttctggcagacaacatcgttgggtctgttctggttttctcc
ttgatattttggattcctttcagcattcttgtccactgtgtggataagaaactggacaag
cagtatgagtccctgtctctgtttcatcacagtaacattgagatgttgagcagcatggac
tcagcatctgttcgcattatcaagccgttccctgcaccccagactccaggtcgtctgcag
gccctgcagccggctgcaatgatgccgccagtgtctgcggctccaaaactggatcaccag
aggatggacaccatccaggaagaccccagcacagattcacatgtggatgatgatggcttt
gagaaggaccccttccccaacagcagtgcagccgccaagtcctttgaggacctcacagac
cacccagtcaccaggagtgagaaggccgcctccttcaagctgcagcgtcagagccgagtt
gatagcaaagagacagagtgttag

DBGET integrated database retrieval system