KEGG   Rattus norvegicus (rat): 298942
Entry
298942            CDS       T01003                                 

Gene name
Dld
Definition
(RefSeq) dihydrolipoyl dehydrogenase, mitochondrial precursor
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00020  Citrate cycle (TCA cycle)
rno00260  Glycine, serine and threonine metabolism
rno00280  Valine, leucine and isoleucine degradation
rno00310  Lysine degradation
rno00380  Tryptophan metabolism
rno00620  Pyruvate metabolism
rno00630  Glyoxylate and dicarboxylate metabolism
rno00640  Propanoate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01240  Biosynthesis of cofactors
Module
rno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rno_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rno_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
rno_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
rno_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    298942 (Dld)
   00020 Citrate cycle (TCA cycle)
    298942 (Dld)
   00620 Pyruvate metabolism
    298942 (Dld)
   00630 Glyoxylate and dicarboxylate metabolism
    298942 (Dld)
   00640 Propanoate metabolism
    298942 (Dld)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    298942 (Dld)
   00280 Valine, leucine and isoleucine degradation
    298942 (Dld)
   00310 Lysine degradation
    298942 (Dld)
   00380 Tryptophan metabolism
    298942 (Dld)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    298942 (Dld)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     298942 (Dld)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   298942 (Dld)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_oxidored NAD_binding_8 GIDA FAD_binding_2 AlaDh_PNT_C HI0933_like FAD_binding_3 K_oxygenase Thi4 DAO Mqo
Other DBs
NCBI-GeneID: 298942
NCBI-ProteinID: NP_955417
RGD: 735073
Ensembl: ENSRNOG00000006364
UniProt: Q6P6R2
LinkDB
Position
6
AA seq 509 aa
MQSWSRVYCSLAKKGHFNRLSHGLQGASSVPLRTYSDQPIDADVTVIGSGPGGYVAAIKA
AQLGFKTVCIEKNETLGGTCLNVGCIPSKALLNNSHYYHLAHGKDFASRGIEIPEVRLNL
EKMMEQKRSAVKALTGGIAHLFKQNKVVHVNGFGKITGKNQVTATTADGSTQVIGTKNIL
IATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKLVVIGAGVIGVELGSVWQRLGADVT
AVEFLGHVGGIGIDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGKIDVSVEAASGGK
AEVITCDVLLVCIGRRPFTQNLGLEELGIELDPKGRIPVNTRFQTKIPNIFAIGDVVAGP
MLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGVEFKVGK
FPFAANSRAKTNADTDGMVKILGHKSTDRILGAHILGPGAGEMVNEAALALEYGASCEDV
ARVCHAHPTLSEAFREANLAASFGKPINF
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgcagagctggagtcgtgtgtactgctccttggccaagaaaggccatttcaatcggctg
tctcatggcctacagggggcttcttcagttccattaagaacttattcagatcaaccaatt
gatgctgatgtgacagtgataggttctggtcctggaggatatgttgctgccatcaaagct
gcccagttaggctttaagacagtctgcattgagaagaatgaaacactaggaggaacatgc
ttgaatgttggttgtattccttcaaaggctttattaaataattctcattattaccatttg
gcccatggaaaagattttgcatctaggggaattgaaataccagaagttcgcttgaattta
gagaagatgatggagcagaagcgttctgcagtaaaagcattaacagggggaattgcccac
ttattcaaacaaaataaggttgttcatgtcaatggatttggaaagataactggcaagaat
caggttacagctacaacggccgatggcagcactcaggttattggtaccaaaaacatcctt
atagctacgggctcagaagttactccttttcccggaatcacgattgatgaagacactata
gtgtcgtctacgggagctttatccttaaaaaaagttccagagaagttggttgttattggt
gcaggagtaatcggtgtggaattgggttcagtttggcaaagacttggtgcagatgtgaca
gcggttgaatttttgggtcatgtgggtggaattggaatcgacatggagatatctaaaaat
tttcaacgtattcttcaaaagcaaggatttaagtttaagctgaatacaaaagttactggt
gccaccaagaagtcagatggaaaaattgatgtgtctgtcgaagctgcatctggtgggaaa
gctgaagtcatcacgtgtgatgtactcttggtttgcatcggtcgacggccctttacgcag
aatttgggactagaagagcttggaattgaactagatcccaaaggtagaattccagtcaat
accagatttcaaactaaaattccaaatatctttgctattggagatgtggttgctggtcca
atgttggctcacaaagcagaagatgaaggcatcatctgtgtggaaggaatggcgggtggt
gctgtgcacattgattataattgtgtgccttcagtgatttacacacaccccgaggttgct
tgggttggcaaatcagaagaacagttgaaagaagagggtgtcgagttcaaagttggaaaa
ttcccatttgctgcaaacagcagagctaaaacaaatgctgacacagatggcatggtcaag
attcttggacataaatccacagatagaatactgggagcacatattctaggaccaggtgct
ggagaaatggtgaatgaagccgccctggcattggaatatggagcgtcctgtgaagacgta
gctagagtctgccatgcacatccgaccttatcagaggcttttagagaagcaaacttggct
gcgtcttttggcaaaccaatcaacttttaa

DBGET integrated database retrieval system