KEGG   Rattus norvegicus (rat): 300802
Entry
300802            CDS       T01003                                 
Symbol
Aph1b
Name
(RefSeq) gamma-secretase subunit APH-1B
  KO
K06172  gamma-secretase subunit APH-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04330  Notch signaling pathway
rno05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    300802 (Aph1b)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    300802 (Aph1b)
SSDB
Motif
Pfam: Aph-1
Other DBs
NCBI-GeneID: 300802
NCBI-ProteinID: NP_001040555
RGD: 1562468
UniProt: Q0PY50
LinkDB
Position
8:complement(67429198..67454735)
AA seq 257 aa
MTAPVFFGCAFIAFGPALALYLFTIATDPLRVIFLIAGAFFWLVSLLLSSVFWFLVRVIT
DNRDGPVQNYLLIFGVLLSVCIQELFRLAYYRLLKKASEGLKSINPEETAPSMRLLAYVS
GLGFGIMSGVFSFVNTLSNALGPGTVGIHGDSPQFFLNSAFMTLVIIMLHVFWGIVFFDG
CEKNKWYILLTVLLTHLLVSTQTLLSPHYEVNLVTAYIIMVLMGIWAFCVAGGSRRSLKL
CLLCQDKDFLLYNQRSR
NT seq 774 nt   +upstreamnt  +downstreamnt
atgacagcgcccgtgttcttcggttgcgccttcatcgccttcgggcccgcgctcgctctc
tacctcttcaccatcgccaccgaccctttgcgagtcatcttcctcatcgccggtgccttc
ttctggttggtgtctctgctgctttcgtctgttttctggttcctagtgagagtcatcact
gacaacagagatggaccagtacagaattacctgctcatctttggagtgttgctctctgtc
tgtatccaagagctgttcaggctcgcatattataggctgttaaaaaaagccagcgagggt
ttgaaaagcataaaccctgaggagacagcaccttcgatgcgactgttggcctatgtttct
ggcttgggctttggaatcatgagtggagtgttttcctttgtgaacaccctgtctaatgcc
ttggggccaggcacagtgggcattcatggtgattctcctcagttcttccttaattcagct
ttcatgacgctggttatcataatgctgcacgtgttctggggcatcgtgttttttgacggc
tgtgagaagaataagtggtacatcctcctcacagttctcctgacccacctgctggtgtcc
acccagactttactaagtcctcactatgaagtgaatctggtgacagcatatataatcatg
gtgctcatgggcatctgggcattctgtgttgctggaggcagccgccgaagcctgaaactc
tgtctgctctgccaagacaaggactttcttctttacaaccagcgctccagataa

KEGG   Rattus norvegicus (rat): 365872
Entry
365872            CDS       T01003                                 
Symbol
Aph1a
Name
(RefSeq) gamma-secretase subunit APH-1A
  KO
K06172  gamma-secretase subunit APH-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04330  Notch signaling pathway
rno05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    365872 (Aph1a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    365872 (Aph1a)
SSDB
Motif
Pfam: Aph-1 Peptidase_M3_N
Other DBs
NCBI-GeneID: 365872
NCBI-ProteinID: NP_001014277
RGD: 1311546
Ensembl: ENSRNOG00000023816
UniProt: Q5PQQ3
LinkDB
Position
2:183437676..183443113
AA seq 247 aa
MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVT
DRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYV
SGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFD
ACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFVTAGGSLRSIQ
RSLSCKD
NT seq 744 nt   +upstreamnt  +downstreamnt
atgggggctgctgtgtttttcggatgcaccttcgtcgcgttcggcccagccttcgccctt
ttcctgattactgtagccggagaccctcttcgggttatcatcctggtggcgggagccttt
ttctggctggtttccctgctcttggcctctgtggtctggttcatcttggtccatgtgaca
gaccgatcagatgcacggctccagtatggcctcctgatttttggtgctgctgtctctgtc
cttctacaggaagtgttccgttttgcctactacaagctccttaagaaggcagatgagggc
ttagcatcactaagtgaggacggaagatcgcccatctccatccgacagatggcctatgtt
tctggtctgtccttcggtatcatcagtggtgtcttctctgttatcaatattttggctgat
gcacttgggccaggtgtggttgggatccatggagactcaccctattacttcctgacttca
gcttttctgacagcagccattatcctgctccataccttttggggagttgtgttctttgat
gcctgtgagaggagacggtactgggctttgggcctggtagttgggagtcaccttctgact
tcaggactgacattcctgaacccctggtatgaggccagcctgctgcccatctatgcagtc
accgtttccatggggctctgggcattcgtcacagccggaggctccctccggagtatccag
cgcagcctttcgtgtaaggactga

KEGG   Rattus norvegicus (rat): 691658
Entry
691658            CDS       T01003                                 
Name
(RefSeq) gamma-secretase subunit APH-1B isoform X4
  KO
K06172  gamma-secretase subunit APH-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04330  Notch signaling pathway
rno05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    691658
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    691658
SSDB
Motif
Pfam: Aph-1 AmoC
Other DBs
NCBI-GeneID: 691658
NCBI-ProteinID: XP_001079175
RGD: 1597236
LinkDB
Position
8:complement(67341790..67363967)
AA seq 216 aa
MTAAVFFGCAFIAFGPALSLYVFTIATDPLRVIFLIAGAFFWLVSLLLSSVFWFLVRVIT
DNRDGPVQNYLLIFGVLLSVCIQELFRLAYYRLLKKANEGLKSINPEETAPSMRLLAYAF
MTLVIIMLHVFWGIVFFDGCEKNKWYILLTVLLTHLLVSTQTLLSPHYEVNLVTAYIIMV
LMGIWAFCVAGGSRRSLKLCLLCQDKDFLLYNQRSR
NT seq 651 nt   +upstreamnt  +downstreamnt
atgacggctgcggtgttctttggttgcgccttcatcgccttcgggcccgcgctctccctt
tacgtcttcaccatcgccactgatcctttgcgagtcatcttcctcatcgccggtgccttc
ttctggttggtgtctctgctgctttcgtctgttttctggttcctagtgagagtcatcact
gacaacagagatggaccagtacagaattacctgctcatctttggagtgttgctctctgtc
tgtatccaagagctgttcaggcttgcatattataggctgttaaaaaaagccaatgagggt
ttgaaaagcataaaccctgaggagacagcaccctcgatgcgactgttggcctatgctttc
atgacgctggttatcataatgctgcacgtgttctggggcatcgtgttttttgacggctgt
gagaagaataagtggtacatcctcctcacagttctcctgacccacctgctggtgtccacc
cagactttactaagtcctcactatgaagtgaatctggtgacagcatatataatcatggtg
ctcatgggcatctgggcattctgtgttgctggaggcagccgccgaagcctgaaactctgt
ctgctctgccaagacaaggactttcttctttacaaccagcgctccagataa

DBGET integrated database retrieval system