KEGG   Rattus norvegicus (rat): 310687
Entry
310687            CDS       T01003                                 
Symbol
Prcc
Name
(RefSeq) proline-rich protein PRCC
  KO
K13105  proline-rich protein PRCC
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05202  Transcriptional misregulation in cancer
rno05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    310687 (Prcc)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    310687 (Prcc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    310687 (Prcc)
Spliceosome [BR:rno03041]
 Complex B
  Other components
   Prp19-related factors
    310687 (Prcc)
SSDB
Motif
Pfam: PRCC
Other DBs
NCBI-GeneID: 310687
NCBI-ProteinID: NP_001101170
RGD: 1309037
Ensembl: ENSRNOG00000012933
UniProt: B2RYA6
LinkDB
Position
2:complement(173326261..173351799)
AA seq 489 aa
MSLVAYASSDDSEPDEPEPEPEEEDVAAPMSGPTLGGLFASLPAPKGPALLHPPPQMLAP
AFPPPLLLPPPTGDPRLQPPPPLPFGLGGFPPPAGVSPAEAAGVGEGLGLPSPQGPGLSL
PPAVGSVGPPLGLPKPKKRTEPVRIAAPELHKGDSDSEEDEPAKKKVVLQGSGEGTGLSA
LLPQPKNLTVKETNRLLLPHAFSRKPSDVSSDAKPSRLASKTKPASLAPVLGTTTTTPSP
SAIKAAAKSAALQVTKQITQEDDDSDEEVAPENFFSLPDKAEPPGVEPYPYPVPTVPEEL
PPGTEPEPAFQDDAANAPLEFKMAAGSSGAPWMPKPGDDYSYNQFSTYGDANAAGAYYQD
YYSGGYYPAPDPALVPSQEIAPDASFIDDEAFKRLQGKRNRGREEINFVEIKGDDQLSGA
QQWMTKSLTEEKTMKSFSKKKGEQPTGQQRRKHQITYLIHQAKERELELKNTWSENKLSR
RQTQAKYGF
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgtctctggttgcttatgccagcagcgacgatagtgagccggatgagccggagccggag
ccggaggaagaggatgtggcggctcctatgtccgggcccactttaggaggcctgttcgct
tctcttcccgcacccaaaggtccggccttgctgcacccgcccccccagatgctggcccca
gcctttcccccgccgcttttgttgcccccgcccaccggagaccccaggctgcagccgcct
ccacctttgccctttggcctgggcggcttcccgccacctgcaggagtgagccctgccgaa
gctgcaggagttggggaggggctggggctgccatcgcctcaaggccctggtctcagcctg
cccccagctgtgggcagtgtcggaccccccttggggcttcccaagccaaagaagagaacc
gagccggttaggatagcggcgccggagctgcataagggcgattcagattctgaggaagat
gaacccgcaaagaagaaagttgtcctgcagggatccggcgaggggactggtttgtctgcc
ttgcttccccaacctaaaaacctgactgtgaaagagactaacaggttgctcctgccccat
gccttctcccggaaaccctcagatgtctcctcagatgctaagccctctagactggcttct
aagaccaagcccgcctcacttgctcctgttttgggtaccacaaccaccactccatcaccc
tctgccatcaaggctgctgccaagagtgctgccctgcaggtgacaaagcagattacacag
gaggatgatgacagcgatgaggaagttgctcctgagaactttttctccctccctgacaag
gctgagccacctggagttgagccatacccttaccctgtccccactgtccctgaagagctg
cctccaggcacagaaccagaaccagctttccaggacgatgcagccaatgccccccttgag
tttaagatggcagcagggtcaagtggggctccctggatgccgaagcctggggacgactac
agctacaatcagttttccacatatggcgatgccaatgctgctggtgcttattatcaggat
tattacagtggtggctactaccctgcaccggacccggctctggtcccttcccaggaaatt
gcccctgatgcctccttcattgatgatgaagcatttaagcggctacagggcaagaggaac
cgagggagagaggaaatcaactttgtggagatcaaaggtgatgaccagctcagtggggct
cagcagtggatgaccaagtcactgacagaagagaaaaccatgaagtccttcagcaaaaag
aaaggtgagcaaccaactggccagcagcggaggaaacaccagatcacatatctaattcat
caggctaaggagcgggagctggagttgaagaacacgtggtcagaaaacaagctcagtcgc
cggcagacccaagccaaatatggattctag

DBGET integrated database retrieval system