KEGG   Rattus norvegicus (rat): 313152
Entry
313152            CDS       T01003                                 
Symbol
Ifnk
Name
(RefSeq) interferon kappa precursor
  KO
K05441  interferon kappa
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04622  RIG-I-like receptor signaling pathway
rno04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    313152 (Ifnk)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    313152 (Ifnk)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    313152 (Ifnk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    313152 (Ifnk)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interferons
   313152 (Ifnk)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 313152
NCBI-ProteinID: NP_001101395
RGD: 1309045
Ensembl: ENSRNOG00000022990
UniProt: D3ZI34
LinkDB
Position
5:49732073..49734281
AA seq 191 aa
MTLKYLWLVALVALYISPIQSQNCVYLDHTILENMKLLSSIRTTFPLRCLKDITDFEFPQ
EILLYVQHVKKDIKAVTYHISSLALIIFSLKDSISLATEERLERIRSGLFKQVQQARECM
VDEENKNTEEDSTSQHPHSEGFKAVYLELNKYFFRIRKFLVNKKYSFCAWKIVVVEIRRC
FSIFYKLLNMN
NT seq 576 nt   +upstreamnt  +downstreamnt
atgacactgaagtatttatggctggtggccctcgtggctctatacatttcacccatccag
tctcagaactgtgtgtatctggatcataccatcttggaaaacatgaaacttctgagcagc
atcaggaccacctttcccttaagatgtctaaaagatatcacggattttgagtttcctcaa
gagattctgctgtacgtccagcatgtgaaaaaggacataaaggcagtcacctatcatata
tcttctctggcgctaattattttcagtcttaaagactccatctccctggcgacagaggaa
cgcttggaacgtatcagatcgggacttttcaaacaagtgcagcaagctcgagagtgcatg
gtagacgaggagaacaagaacacggaggaggacagtacatcacaacatcctcactcagag
ggcttcaaggcagtctacctggaattgaacaagtatttcttcagaatcagaaagttcctg
gtaaataagaaatacagtttctgtgcctggaagattgtcgtggtggaaataagaagatgt
ttcagtatattttacaaactactcaacatgaattga

DBGET integrated database retrieval system