KEGG   Rattus norvegicus (rat): 314621
Entry
314621            CDS       T01003                                 
Symbol
Stk11
Name
(RefSeq) serine/threonine-protein kinase STK11
  KO
K07298  serine/threonine-protein kinase 11 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04530  Tight junction
rno04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    314621 (Stk11)
   04151 PI3K-Akt signaling pathway
    314621 (Stk11)
   04152 AMPK signaling pathway
    314621 (Stk11)
   04150 mTOR signaling pathway
    314621 (Stk11)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    314621 (Stk11)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    314621 (Stk11)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    314621 (Stk11)
  09149 Aging
   04211 Longevity regulating pathway
    314621 (Stk11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    314621 (Stk11)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     314621 (Stk11)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   314621 (Stk11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like ABC1 Pkinase_fungal Kdo APH Antimicrobial_6
Other DBs
NCBI-GeneID: 314621
NCBI-ProteinID: NP_001101539
RGD: 1308653
Ensembl: ENSRNOG00000014287
UniProt: D4AE59
LinkDB
Position
7:complement(9574553..9591315)
AA seq 436 aa
MDVADPQPLGLFPEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSY
GKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHRNVIQLVDVLYNE
EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFRQLIDGLEYLHSQGIVHKDIKPG
NLLLTTNGTLKISDLGVAEALHPFAVDDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWS
AGVTLYNITTGLYPFEGDNIYKLFENIGRGDFTIPCDCAPPLSDLLRGMLEYEPAKRFSI
RQIRQHSWFRKKHPLAEALVPIPPSPDTKDRWRSMTVVPYLEDLHGRAEEEEDEDLFDIE
DGIIYTQDFTVPGQVLEEEVGQNGQSHSLPKAVCVNGTEPQLSSKVKPEGRPGAANPARK
VCSSNKIRRLSACKQQ
NT seq 1311 nt   +upstreamnt  +downstreamnt
atggacgtggctgacccccagccgttgggcctgttccccgagggcgagctaatgtcggtg
ggcatggacaccttcatccaccgcatcgactccaccgaggtgatctaccagccgcgccgc
aagcgcgccaagctcatcggcaagtacctgatgggggacctgctcggggagggctcgtac
ggcaaggtgaaggaggtgctggactccgagaccttatgccgcagggcggtcaagatcctc
aagaagaaaaagctgcgcaggatccccaatggcgaggccaacgtcaagaaggagatccag
ctgctgcggcggctgcggcatcggaatgtgatccagcttgtggatgtgctgtacaatgag
gagaagcagaagatgtatatggtgatggagtactgcgtgtgtggcatgcaggagatgctg
gacagtgtgccagagaagcgcttccccgtgtgccaagctcatgggtacttccgccagctg
attgacggcctggagtacctacacagccagggcattgttcacaaggacatcaagccgggc
aacctgctcctcaccaccaatggcacactcaagatctccgacctcggtgttgccgaggcc
ttgcaccctttcgctgtggatgacacctgccggaccagccagggctccccagccttccag
cctccagagattgccaatggactggacaccttttcaggtttcaaggtggacatctggtca
gctggggtcacactctacaacatcaccacgggcctgtacccatttgagggggacaatatc
tacaagctctttgagaacatcgggagaggggacttcaccatcccttgtgactgcgctcca
ccactctctgacctactccgagggatgttggagtacgagccagccaagaggttctccatc
cgacagattagacagcacagctggttccggaagaaacacccgctggccgaggctcttgtg
cctatccccccaagtccagacactaaggaccgctggcgcagcatgaccgtagtgccctac
ctggaggacctgcatggccgtgcagaggaggaggaggacgaggacttgtttgacattgag
gacggcatcatctatacccaggacttcacagtgcctggacaggtcctggaagaggaagtg
ggtcagaatggacagagccacagcctgcccaaggctgtttgtgtgaatggcacagagccc
cagctcagcagcaaggtgaagccagaaggccggcctggcgctgccaaccctgcacgcaag
gtgtgctccagcaacaagatccgccggctctcggcctgcaagcagcagtga

DBGET integrated database retrieval system