KEGG   Rattus norvegicus (rat): 361042
Entry
361042            CDS       T01003                                 

Gene name
Pck2
Definition
(RefSeq) phosphoenolpyruvate carboxykinase [GTP], mitochondrial
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00020  Citrate cycle (TCA cycle)
rno00620  Pyruvate metabolism
rno01100  Metabolic pathways
rno03320  PPAR signaling pathway
rno04068  FoxO signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04910  Insulin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
rno04964  Proximal tubule bicarbonate reclamation
Module
rno_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    361042 (Pck2)
   00020 Citrate cycle (TCA cycle)
    361042 (Pck2)
   00620 Pyruvate metabolism
    361042 (Pck2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    361042 (Pck2)
   04151 PI3K-Akt signaling pathway
    361042 (Pck2)
   04152 AMPK signaling pathway
    361042 (Pck2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    361042 (Pck2)
   04922 Glucagon signaling pathway
    361042 (Pck2)
   04920 Adipocytokine signaling pathway
    361042 (Pck2)
   03320 PPAR signaling pathway
    361042 (Pck2)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    361042 (Pck2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    361042 (Pck2)
Enzymes [BR:rno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     361042 (Pck2)
SSDB
Motif
Pfam: PEPCK_GTP PEPCK_N
Other DBs
NCBI-GeneID: 361042
NCBI-ProteinID: NP_001101847
RGD: 1311112
UniProt: B2RYG2
LinkDB
Position
15
AA seq 640 aa
MAAMYLPGLRLSWHRLRPWCRSPCRSIQTLRVLSGDLSQLPAGVRDFVERSAHLCQPAGI
HICDGTEAENAATLALLEEQGLIRKLPKYENCWLARTDPKDVARVESKTVIVTSSQRDTV
PLLAGGASGQLGNWMSPDEFQRAVDQRFPGCMQGRTMYVLPFSMGPLGSPLSRIGVQLTD
SPYVVASMRIMTRLGTHVLQALGDGDFIKCLHSVGQPLTGHGDPVGRWPCNPEKTLIGHV
PEQREIVSFGSGYGGNSLLGKKCFALRIASRLARDEGWLAEHMLILGITNPAGKKRYVAA
AFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSEGQLRAINPENGFFGVAPGTSAT
TNPNAMATIQSNTVFTNVAETSDGGVYWEGIDQPLPPGVTVTSWLGKPWKPGDKEPCAHP
NSRFCVPARQCPIMDPAWEAPEGVPIDAIIFGGRRPKGVPLVYEAFSWRHGVFVGSAMRS
ESTAAAEHKGKTIMHDPFAMRPFFGYNFGHYLEHWLSMEGRKGARLPRIFHVNWFRRDEA
GRFLWPGFGENARVLDWICRRLGGEDSARETPIGLVPKEGALDLSGLRAIDTSQLFSIPK
DFWEQEVRDIRSYLTEQVNQDLPKEVLAELEALEERVQKM
NT seq 1923 nt   +upstreamnt  +downstreamnt
atggctgctatgtacctccccggcctgcggcttagctggcacaggctgaggccctggtgc
cggtcaccatgccgtagcatccaaaccctgcgcgtgctcagtggagatctgagccagctg
ccggctggggttcgagactttgtggagcgcagtgcccatctgtgccaaccagcaggcatc
catatttgtgatgggactgaggctgagaacgctgccacgctggccctgctggaagagcag
ggtcttatccggaagctccccaagtatgagaactgctggctggcccgcacagaccccaag
gatgtggcacgggtagaaagcaagacggtgattgtaacttcttcgcagcgggacacagtg
cctctcctggctggtggggccagtgggcagctgggcaactggatgtccccagatgagttc
cagagagctgtggaccagagattcccaggatgcatgcagggccgcaccatgtatgtgctt
ccgttcagcatgggtcccttgggctccccgctctcccgcattggagtgcagctcactgac
tcgccttatgtagtggcaagcatgcggattatgacccgcctggggacacatgtactccag
gccctgggagatggtgacttcatcaagtgtctgcattcggtgggccagcccctgactgga
catggggatcctgtgggccggtggccatgcaatccggaaaaaaccctgattggccacgtg
ccggagcagcgggagatcgtctccttcggcagcggctatggtgggaactccttgctgggc
aagaagtgttttgccctgcgcatcgcctctcgcctggccagggatgagggctggctggca
gaacacatgctgattttgggcatcaccaaccccgcagggaaaaagcgctatgtggcagct
gctttccccagtgcctgtggcaagaccaatctggccatgatgcggcctgctttgccaggc
tggaaagtggagtgtgtgggggatgacatcgcctggatgaggtttgacagtgaaggtcaa
ctccgggccatcaaccctgagaatggcttcttcggggtggcccctggtacctctgccacc
accaatcccaatgccatggccacaatccagagtaacactgtcttcaccaatgtggctgag
accagtgatggcggtgtgtactgggaaggcattgaccagcctcttccacctggtgtcacc
gtaacctcctggctgggaaagccatggaaacctggggacaaggaaccctgtgcgcatcca
aactctcgcttttgtgtcccggctcgccagtgccccatcatggacccagcctgggaggca
ccagaaggtgttccaattgatgccatcatcttcggaggccgcagacctaaaggggtacca
ctggtgtatgaggccttcagctggcgccatggggtgtttgtcggtagtgccatgcgctct
gagtccactgcagctgctgaacacaagggaaagaccattatgcacgatccctttgccatg
cgacctttttttggctataacttcggacactacctggaacactggttgagcatggaggga
cgaaaaggtgcccggctgcctcgtatcttccatgtcaactggttccggagagatgaagca
ggccgcttcctgtggccaggctttggggaaaacgctcgcgtgctagactggatctgccga
agattaggaggagaagacagtgcccgagagactcccattgggctcgtaccaaaggaagga
gccctggatctcagtggcctccgagcaatagataccagtcagctgttctccatccccaag
gacttctgggaacaggaggttcgtgatattaggagctacctgacagagcaagtcaaccag
gatctgcccaaggaggtgttggctgagctcgaggccctggaagagcgcgtgcaaaaaatg
tga

KEGG   Rattus norvegicus (rat): 362282
Entry
362282            CDS       T01003                                 

Gene name
Pck1
Definition
(RefSeq) phosphoenolpyruvate carboxykinase, cytosolic [GTP]
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00020  Citrate cycle (TCA cycle)
rno00620  Pyruvate metabolism
rno01100  Metabolic pathways
rno03320  PPAR signaling pathway
rno04068  FoxO signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04910  Insulin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
rno04964  Proximal tubule bicarbonate reclamation
Module
rno_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    362282 (Pck1)
   00020 Citrate cycle (TCA cycle)
    362282 (Pck1)
   00620 Pyruvate metabolism
    362282 (Pck1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    362282 (Pck1)
   04151 PI3K-Akt signaling pathway
    362282 (Pck1)
   04152 AMPK signaling pathway
    362282 (Pck1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    362282 (Pck1)
   04922 Glucagon signaling pathway
    362282 (Pck1)
   04920 Adipocytokine signaling pathway
    362282 (Pck1)
   03320 PPAR signaling pathway
    362282 (Pck1)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    362282 (Pck1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    362282 (Pck1)
Enzymes [BR:rno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     362282 (Pck1)
SSDB
Motif
Pfam: PEPCK_GTP PEPCK_N
Other DBs
NCBI-GeneID: 362282
NCBI-ProteinID: NP_942075
RGD: 3267
Ensembl: ENSRNOG00000028616
UniProt: P07379
LinkDB
Structure
PDB: 

Position
3
AA seq 622 aa
MPPQLHNGLDFSAKVIQGSLDSLPQEVRKFVEGNAQLCQPEYIHICDGSEEEYGRLLAHM
QEEGVIRKLKKYDNCWLALTDPRDVARIESKTVIITQEQRDTVPIPKSGQSQLGRWMSEE
DFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLAKIGIELTDSPYVVASMRIMTRMGTSV
LEALGDGEFIKCLHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGYGGNSL
LGKKCFALRIASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTL
PGWKVECVGDDIAWMKFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNV
AETSDGGVYWEGIDEPLAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAW
ESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKVIMHDPF
AMRPFFGYNFGKYLAHWLSMAHRPAAKLPKIFHVNWFRKDKNGKFLWPGFGENSRVLEWM
FGRIEGEDSAKLTPIGYVPKEDALNLKGLGDVNVEELFGISKEFWEKEVEEIDKYLEDQV
NADLPYEIERELRALKQRISQM
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgcctcctcagctgcataatggtctggacttctctgccaaggtcatccagggcagcctc
gacagcctgccccaggaagtgaggaagtttgtggaaggcaatgcccagctgtgccagcca
gagtatattcacatctgcgacggctccgaggaggagtacgggcggctgctggcccacatg
caggaggagggtgtcatccgcaagctgaagaaatatgacaactgttggctggctctcact
gaccccagggatgtggccaggatcgaaagcaagacggtcatcattacccaagagcagaga
gacaccgtgcccatccccaaaagtgggcagagccagctgggccgctggatgtcagaagag
gacttcgagaaagcattcaacgccaggttcccggggtgcatgaaaggccgcaccatgtat
gtcatcccattcagcatggggccgctgggctcacctctggccaagattggtattgagctg
acagactcgccctatgtggtggccagcatgcggatcatgacacggatggggacctctgtg
ctggaggccctgggcgatggggagtttatcaagtgcctccactccgtggggtgccctctc
cccttaaaaaagcctttggtcaacaactgggcctgcaaccccgagctgaccctgattgct
cacctcccggaccgcagagagatcatctccttcggaagcggatacggtgggaactcactg
cttgggaagaaatgctttgcgctgcggatcgccagcaggctggctaaggaggaagggtgg
ctggcggagcacatgctgatcctgggcataactaaccccgaaggcaagaagaaatacctg
gcagcagccttccccagtgcctgtgggaaaaccaacctggccatgatgaaccccaccctc
cccgggtggaaagttgaatgtgtgggtgatgacattgcctggatgaagtttgatgcccaa
ggcaacttaagggccatcaacccagaaaacggtttttttggagttgctccgggcacctca
gtgaagacaaatccgaacgccattaagaccatccagaaaaacaccatcttcaccaacgtg
gctgagacaagtgatgggggtgtttactgggaaggcatcgatgagcccctggccccagga
gtcaccatcacttcctggaagaacaaagagtggagaccacaggatgaggaaccgtgcgcc
catcccaactcgcgattctgcacccctgccagccaatgtcccattattgaccccgcctgg
gaatctcctgaaggagtgcccatcgaaggcatcatttttggtggccgtagacctgcaggt
gtcccccttgtctacgaagctctcagctggcagcatggggtgtttgtaggagctgccatg
agatcagaggccaccgctgctgcagagcataagggcaaggtcatcatgcacgaccccttc
gctatgcggcccttctttggctacaacttcggcaagtacctggcgcactggctgagcatg
gcccaccgcccagcagccaagttgcccaagatcttccacgtcaactggttccggaaagac
aaaaacggcaagttcctctggcccggatttggtgagaactcccgcgtgctggagtggatg
ttcggacgcatcgaaggggaagacagcgccaagctcactcccattggctacgtccctaag
gaagacgccctgaacttgaaaggcctgggggacgtcaacgtggaggagctgttcggaatc
tctaaggaattctgggagaaggaggtggaggagatcgacaagtatctggaggaccaggtc
aacgccgacctcccttacgaaatagagagggagctccgagccctgaaacagagaatcagc
cagatgtaa

DBGET integrated database retrieval system