KEGG   Rattus norvegicus (rat): 362007
Entry
362007            CDS       T01003                                 
Symbol
Sike1
Name
(RefSeq) suppressor of IKBKE 1
  KO
K12656  suppressor of IKK-epsilon
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    362007 (Sike1)
SSDB
Motif
Pfam: SIKE Herpes_BLRF2 Beta_protein DUF4250 TSC22
Other DBs
NCBI-GeneID: 362007
NCBI-ProteinID: NP_001012182
RGD: 1311316
Ensembl: ENSRNOG00000017502
UniProt: Q5FWT9
LinkDB
Position
2:190518002..190525833
AA seq 207 aa
MSCTIEKILTDAKTLLERLREHDAAAESLVDQSAALHRRVAAMREAGAVLPEQYQEDASD
VKDMSKYKPHILLSQENTQIRDLQQENRELWVSLEEHQDALELIMSKYRKQMLQLMVAKQ
AVDAEPVLKAHQSHSAEIESQIDRICEMGAVMRRAVQVDDNQFCKIQEKLAQLELENKEL
RELLSISSESLQVGKESSVAPEAQTIR
NT seq 624 nt   +upstreamnt  +downstreamnt
atgagctgtacgatcgagaagatcttgacggacgccaagacgctgctggagcggctgcgc
gaacacgatgcggcggccgagtcgctggtggaccagtcggccgcgctgcaccggcgggtg
gctgcgatgcgggaggcgggcgccgtgttgccggagcagtatcaagaggatgcatccgac
gtgaaggacatgtctaaatataaacctcacattctgctgtctcaagagaatactcagatt
agagacttacagcaggaaaacagagagctgtgggtctccttggaggagcaccaggatgca
ttggaactcatcatgagcaagtaccggaaacaaatgttacagttaatggttgctaaacaa
gcagtggatgctgaaccagttttgaaagctcatcagtctcactctgcagaaattgaaagt
cagatcgatagaatctgtgaaatgggagcagtgatgcggagagcggttcaggtggacgat
aaccagttctgtaagattcaggagaaactagctcaactggagcttgaaaataaggaactt
cgagaattactgtccatcagcagtgagtctctccaggttggaaaagaaagctctgtggct
cccgaggctcagaccatcaggtaa

DBGET integrated database retrieval system