KEGG   Rattus norvegicus (rat): 363452
Entry
363452            CDS       T01003                                 
Symbol
Otud5
Name
(RefSeq) OTU domain-containing protein 5
  KO
K12655  OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    363452 (Otud5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    363452 (Otud5)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    363452 (Otud5)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     363452 (Otud5)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C85
   363452 (Otud5)
Ubiquitin system [BR:rno04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   OTU
    363452 (Otud5)
SSDB
Motif
Pfam: OTU Peptidase_C65
Other DBs
NCBI-GeneID: 363452
NCBI-ProteinID: NP_001032585
RGD: 1563027
Ensembl: ENSRNOG00000008764
UniProt: Q2YDU3
LinkDB
Position
X:complement(14626173..14659331)
AA seq 523 aa
MTILPKKKPPPPDADPANEPPPPGPLPPAPRRGGGVGVGGGGTGVGGGERDRDSGVVGAR
PRASPPPQGPLPGPPGALHRWALAVPPGAVAGPRPQQASPPPCGGPGGPGGGPGDALVGG
ASPEREEVGAGYNSEDEYEAAAARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGA
CLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHI
EMQAMAEMYNRPVEVYQYSTEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGV
GLGLPSFKPGFAEQSLMKNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYL
QWLRDQEKQARQVRGPSQPRKASATCSSATAAASSGLEEWTSRSPRQRSSASSPEHPELH
AELGIKPPSPGTVLALAKPPSPCAPGTSSQFSAGADRATSPLVSLYPALECRALIQQMSP
SAFGLNDWDDDEILASVLAVSQQEYLDSMKKNKVHRDPPPDKS
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgactattctccccaaaaagaagccgccacctcccgacgccgacccggccaacgaaccg
ccgccgcccgggccgctgcccccagcgcctcggcgcggtgggggtgtaggcgtgggcggc
ggcggcacgggcgtgggcggaggagagcgcgaccgtgactccggcgtcgtgggggcccgt
ccccgggcttcaccaccacctcagggaccgctaccggggccgcctggtgctcttcatcgt
tgggcactagccgtgccgcctggcgcagtcgcgggccctcggccacagcaggcttctcca
cctccttgtgggggccctggtggccccggcggcggtcccggtgacgctcttgttggcggg
gccagtccggaacgtgaagaggtcggagcaggctacaacagcgaagacgaatatgaagct
gctgcagcacgaatcgaggccatggatcccgccactgtagaacagcaggaacactggttt
gaaaaggccttgcgggacaagaaaggcttcatcatcaagcagatgaaggaggatggtgcc
tgtctattccgggctgtagctgaccaggtgtatggagaccaggacatgcatgaggttgtg
cgaaagcattgcatggactatctgatgaagaatgccgattacttttccaactatgtcaca
gaagacttcaccacctatatcaatcggaagcggaaaaacaactgccatgggaaccacatt
gagatgcaggctatggcagagatgtacaaccgtcctgtggaggtgtatcagtatagcaca
gaacctatcaacacattccatgggatccatcaaaatgaagatgaacccatccgtgtcagc
taccaccggaatatccactataattcagtggtgaatcctaacaaggccactattggtgtg
gggctgggcctgccatcatttaaaccagggtttgcagagcagtccctgatgaagaatgcc
ataaagacatcagaagagtcatggattgaacagcaaatgctggaagacaagaaacgagct
acagactgggaggccacaaatgaggccatagaggagcaggtggctcgagaatcttacctg
cagtggctgagggatcaagagaaacaggcccgccaggtccggggacccagccagccacgg
aaagccagtgccacatgcagttcagccacagcagcagcctccagtggcctggaggaatgg
actagtcggtccccacggcaacgaagttcagcctcgtcacctgagcaccctgaactgcat
gccgagctaggcattaagcccccttccccaggcactgtgttagctcttgccaaacctcct
tcaccctgtgcaccaggtacaagcagtcagttctcagcaggggctgatcgggccacctct
cctcttgtgtccctctaccctgctctggagtgccgggccctcatccagcagatgtccccc
tctgcctttggtctgaatgattgggatgatgatgagatcctagcatcggtgctggcagtg
tcccaacaggaatacctagacagtatgaagaaaaacaaagtgcacagagacccaccccca
gacaagagttga

DBGET integrated database retrieval system