KEGG   Rattus norvegicus (rat): 363520
Entry
363520            CDS       T01003                                 
Symbol
Irak1
Name
(RefSeq) interleukin-1 receptor-associated kinase 1
  KO
K04730  interleukin-1 receptor-associated kinase 1 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04064  NF-kappa B signaling pathway
rno04620  Toll-like receptor signaling pathway
rno04722  Neurotrophin signaling pathway
rno04936  Alcoholic liver disease
rno05132  Salmonella infection
rno05133  Pertussis
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05162  Measles
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    363520 (Irak1)
   04064 NF-kappa B signaling pathway
    363520 (Irak1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    363520 (Irak1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    363520 (Irak1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    363520 (Irak1)
   05161 Hepatitis B
    363520 (Irak1)
   05171 Coronavirus disease - COVID-19
    363520 (Irak1)
   05162 Measles
    363520 (Irak1)
   05168 Herpes simplex virus 1 infection
    363520 (Irak1)
   05169 Epstein-Barr virus infection
    363520 (Irak1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    363520 (Irak1)
   05135 Yersinia infection
    363520 (Irak1)
   05133 Pertussis
    363520 (Irak1)
   05152 Tuberculosis
    363520 (Irak1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    363520 (Irak1)
   05140 Leishmaniasis
    363520 (Irak1)
   05142 Chagas disease
    363520 (Irak1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    363520 (Irak1)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    363520 (Irak1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    363520 (Irak1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     363520 (Irak1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: TKL group
  IRAK family
   363520 (Irak1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Death RAMP APH Seadorna_VP7
Other DBs
NCBI-GeneID: 363520
NCBI-ProteinID: NP_001121027
RGD: 1563841
Ensembl: ENSRNOG00000060869
UniProt: B2RYH5
LinkDB
Position
X:complement(151768621..151778521)
AA seq 710 aa
MAGGPGPGEPVVPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCE
RSEQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPASVLPPSTGAPRPSS
ISAGSETEDWSPRKLQSSASTFLSPAFPGSQTHSESELLQVPLSDSLGPPLQSSAPSSIK
PSPESPVSGLQRARPSPFCWPFCEISQGTCNFSEELRIGEGGFGCVYRAVMRNTTYAVKR
LKEEADLEWTVVKQSFLTEVEQLSRFRHPNIVDFAGYCAESGFYCLVYGFLPNGSLEDQL
HLQTQACSPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLMPKLGDFG
LARFSRFAGANPSQSSTVARTCTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVILETLAG
QRAVRTQGAKTKYLKDLIEDEAEEVGVTLKSTQPTLWMGVATDAWTAPIAAQIYKKHLDS
RPGPCPPQLGLALAQLACCCMHRRAKKRPPMTQVYKRLEGLQAVPPWKLEVAGHGSPSPQ
ENSYMSTTGSAQSGDEPWQPLVVTTRAPAQAAQQLQRSPNQPVESDESVPGLSATLHSWH
LTPDSHPSPVSFREASCTQGGTTRESSLRSGPGFQPTTMEGSSMGSSSLLSSEPPQIIIN
PARQKMVQKLALYEEGVLDSLQLLSSGFFPGLDLEPEKRKRPEESDEFQS
NT seq 2133 nt   +upstreamnt  +downstreamnt
atggccgggggcccgggccccggggagcctgtggttcccggcgcccagcatttcttgtac
gaggtgcctccctgggttatgtgccgtttctacaaagtgatggacgccctggagcccgcc
gactggtgccagttcgcggccttgatcgtgcgcgaccagacagagctgcggctgtgtgag
cgctccgagcagcgcacggccagtgtcctgtggccctggatcaaccgcaacgcgcgtgtg
gctgacctcgttcacatcctcacgcacctgcagctgctgcgtgcgcgggacatcattaca
gcctggcaccctcctgcctctgttctgcccccaagcaccggtgccccaaggcccagcagc
atctctgcaggctctgagactgaggactggagcccccggaaattgcagtcctctgcctcc
accttcctctccccagcttttccaggctcccagacccattctgagtcagagctcctccag
gttccactctctgattccctcgggccaccactacaatcttcagccccctcctccatcaag
ccaagcccagagagcccagtgtctggcctccaaagagctcgtccctccccattttgctgg
cccttctgtgagatttcccaaggcacttgcaacttctctgaagaactcaggattggagag
ggtggttttgggtgtgtgtaccgagcagtaatgagaaatactacatatgctgtgaagaga
ctgaaggaggaggctgacctagagtggactgtggtgaaacagagcttcctaacagaggtg
gaacagctatcaaggtttcgtcacccaaatatcgtggactttgctggctactgtgcagag
agtggcttctactgccttgtttatggcttcctgcccaatggctccttagaggatcagctt
caccttcagacccaagcctgctccccactttcctggcctcaacgactggacattcttctg
ggcacagcccgggctattcagtttttacatcaggacagccccagccttatccatggagac
atcaagagttctaatgtgcttctggatgagagactgatgcccaagctgggagactttggt
ctggctcgtttcagccgctttgcaggggccaacccaagccagagcagtactgtggcccgg
acttgcacagttcgaggtaccctcgcctacctgcctgaggagtacatcaagacaggccgg
ctggctgtggacaccgataccttcagctttggggtggtaatactggagacccttgctggt
cagagggctgtgaggacacaaggtgcaaaaaccaaatatctgaaagacctgattgaagat
gaggctgaagaggtgggagtgaccttaaaaagcacccagcctactttgtggatgggtgta
gccacggatgcttggactgctccaattgctgcccagatctataagaagcacctggactcc
agacctgggccctgcccaccccagttgggcctggccctggctcaactagcttgctgctgc
atgcaccgtcgggccaagaagaggccacccatgacccaggtatacaagagactagaaggg
cttcaggcagtacctccctggaagctagaggttgccggccatggctctccttccccacag
gagaactcctacatgtccaccactggcagtgcccagagtggggatgaaccatggcagcct
ctggtagtgaccacaagagctccagcccaggctgcccagcaactccagagaagtcccaac
cagccagtggagagtgatgagagtgttcctggcctctctgctaccctgcattcctggcac
ttgactccagattcccacccaagccctgtgtccttcagagaggctagctgtacacaagga
ggcactaccagagaatcaagtttgaggagtggcccaggcttccagcctacgaccatggaa
ggctcatcgatgggcagttcatccctgctgtcatcagagccaccacagatcatcatcaac
ccagcccgacagaagatggtacaaaagctggccctgtatgaagagggggtcttggatagc
ctgcaactgctgtcatcaggctttttcccaggcttggatttagaacctgaaaagagaaag
agacctgaagaaagtgatgaattccagagctga

DBGET integrated database retrieval system