KEGG   Rattus norvegicus (rat): 365601
Entry
365601            CDS       T01003                                 
Symbol
Atg5
Name
(RefSeq) autophagy protein 5
  KO
K08339  autophagy-related protein 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04136  Autophagy - other
rno04137  Mitophagy - animal
rno04140  Autophagy - animal
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04216  Ferroptosis
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    365601 (Atg5)
   04136 Autophagy - other
    365601 (Atg5)
   04137 Mitophagy - animal
    365601 (Atg5)
  09143 Cell growth and death
   04216 Ferroptosis
    365601 (Atg5)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    365601 (Atg5)
   04622 RIG-I-like receptor signaling pathway
    365601 (Atg5)
  09149 Aging
   04211 Longevity regulating pathway
    365601 (Atg5)
   04213 Longevity regulating pathway - multiple species
    365601 (Atg5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    365601 (Atg5)
   03029 Mitochondrial biogenesis [BR:rno03029]
    365601 (Atg5)
Membrane trafficking [BR:rno04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    365601 (Atg5)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    365601 (Atg5)
SSDB
Motif
Pfam: APG5 DUF6782
Other DBs
NCBI-GeneID: 365601
NCBI-ProteinID: NP_001014272
RGD: 1359580
UniProt: Q5XIS0
LinkDB
Position
20:47798222..47889216
AA seq 217 aa
MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQKVM
RQEDVSEIWFEYEGTPLKWHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPCKDA
VEAHFMSCVKEADALKHKSQVINEMQRKDHKQLWMGLQNDLTSFGPSTGNSWNTLQKKMD
FVISLLEYIRPQLNGLSFRSCSVLWPQMDSCIPLEIS
NT seq 654 nt   +upstreamnt  +downstreamnt
atgacagatgacaaagatgtgcttcgagacgtgtggtttggacggattccaacgtgcttt
actctctatcaggatgagataactgaacgagaagcagagccatactatttgcttttgcca
agagtcagctatttgacgctggtaactgacaaagtgaaaaagcactttcagaaggttatg
agacaagaagatgttagtgagatttggtttgaatatgaaggcacacccctgaaatggcat
tatccaattggcctactgttcgatcttcttgcatcaagctcagctctgccttggaacatc
acagtacatttcaagagttttccagaaaaggaccttctgcactgtccgtgcaaggatgca
gttgaggctcactttatgtcatgtgtgaaggaagctgacgctttaaagcacaaaagtcag
gtgatcaacgaaatgcagagaaaagaccacaagcagctctggatgggactgcagaatgat
ttgaccagttttggaccatcaaccggaaactcatggaataccctccagaagaaaatggat
ttcgttatatcccttttagaatatatcagaccacaactgaacggcctttcattcagaagc
tgttccgtcctgtggccgcagatggacagctgcatacccttggagatctcctaa

DBGET integrated database retrieval system