Rattus norvegicus (rat): 498753 Help Entry 498753            CDS       T01003                                  Symbol Hist1h2af Name (RefSeq) histone H2a   KO K11251   histone H2A Organism rno  Rattus norvegicus (rat) Pathway rno03082   ATP-dependent chromatin remodeling rno04217   Necroptosis rno04613   Neutrophil extracellular trap formation rno05034   Alcoholism rno05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:rno00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     498753 (Hist1h2af)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     498753 (Hist1h2af)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     498753 (Hist1h2af)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     498753 (Hist1h2af)   09165 Substance dependence    05034 Alcoholism     498753 (Hist1h2af)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rno03036]     498753 (Hist1h2af)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rno04147]     498753 (Hist1h2af) Chromosome and associated proteins [BR:rno03036]  Eukaryotic type   Nucleosome assembly factors    Histones     498753 (Hist1h2af) Exosome [BR:rno04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    498753 (Hist1h2af) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF ParE_like Motif Other DBs NCBI-GeneID:  498753 NCBI-ProteinID:  NP_001019453 RGD:  1564767 Ensembl:  ENSRNOG00000022146 UniProt:  A0A8L2QLK6 Q6I8Q6 LinkDB All DBs Position 17:complement(41807261..41807653) Genome browser AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLYKGNYSERVGASAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK TESHHKSKGK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgcggcaagcagggcggcaaggctcgggctaaggccaagacccgctcctcc cgggccggcctgcagttccccgtgggccgcgtgcaccgtctgctttacaagggcaactac tcggagagggtgggcgccagcgccccggtgtacttggcggctgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcgagggacaacaaaaagacacgcatcatc ccgcgccacctacagctggccattcgcaacgatgaggagctcaacaagctgctgggccgt gtgaccatcgcgcagggcggcgtcctgcccaacatccaggcagtgctgctgcccaaaaag accgagagccaccacaagtccaaggggaaatag

DBGET integrated database retrieval system