KEGG   Rattus norvegicus (rat): 65190
Entry
65190             CDS       T01003                                 
Symbol
Rsad2
Name
(RefSeq) radical S-adenosyl methionine domain-containing protein 2
  KO
K15045  radical S-adenosyl methionine domain-containing protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05160  Hepatitis C
rno05164  Influenza A
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    65190 (Rsad2)
   05164 Influenza A
    65190 (Rsad2)
SSDB
Motif
Pfam: Radical_SAM Fer4_14 Fer4_12
Other DBs
NCBI-GeneID: 65190
NCBI-ProteinID: NP_620236
RGD: 620495
Ensembl: ENSRNOG00000007539
UniProt: O70600
LinkDB
Position
6:complement(43046514..43059737)
AA seq 360 aa
MLVPTALAARLLSLFQQQLGSLWSGLAMLFCWLRIALGWPDPGKGQPRVRGEPKETQETH
EDPGSAQPTTPVSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKQAGMEKIN
FSGGEPFLQDRGEYLGKLVRFCKEELALPSVSIVSNGSLIRERWFKDYGDYLDILAISCD
SFDEQVNVLIGRGQGKKNHVENLQKLRKWCRDYKVAFKINSVINRFNVDEDMNEHIKALS
PVRWKVFQCLLIEGENSGEDALREAERFLISNEEFEAFLQRHKDVSCLVPESNQKMKDSY
LILDEYMRFLNCTGGRKDPSRSILDVGVEEAIKFSGFDEKMFLKRGGKYVWSKADLKLDW
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgctagtgcctactgcgctggctgctcggctgctgagcctgttccagcaacagctgggt
tccctctggagtggcctggccatgctgttctgctggctgagaatagcattggggtggcca
gatcctggaaagggacagccacgggtccggggtgagcccaaggagactcaggagacccac
gaagatccaggcagtgctcagcccacaacccccgttagtgtcaactaccacttcacgcgt
cagtgcaactacaaatgtggcttctgcttccacacggccaagacatccttcgtgctgccc
ctggaggaggccaagcgaggactgcttctgctcaaacaggctggtatggagaagatcaac
ttttcaggaggagaacccttcctacaggacaggggtgaatacttgggcaagctcgtgaga
ttctgcaaggaggagctagccctgccctctgtgagcatagtgagcaatggcagccttatc
cgagagagatggttcaaggactatggagactatttggacattcttgctatctcctgtgac
agctttgatgagcaggttaatgttctcattggtcgtggccaagggaaaaagaaccatgtg
gaaaaccttcaaaagctgcggaagtggtgcagggattacaaggtggctttcaagatcaat
tccgtcattaatcgcttcaacgtggacgaagatatgaatgagcacatcaaggcgctgagc
cctgtccgctggaaggttttccaatgcctcctgattgagggtgagaactcaggagaagat
gccctgagggaagcagaaagatttcttataagcaatgaagaatttgaagcattcttacag
cgtcacaaagatgtgtcctgcttggtgcctgaatctaaccagaagatgaaagactcctac
cttatcctggatgaatatatgcgctttctgaactgtaccggtggccggaaggacccttcc
aggtccatcctggatgttggcgtggaggaagcgatcaaattcagtgggtttgatgagaag
atgtttctgaagcgcggggggaagtatgtatggagtaaggctgacctgaagctagactgg
tga

DBGET integrated database retrieval system