KEGG   Rattus norvegicus (rat): 78959
Entry
78959             CDS       T01003                                 

Gene name
Akr1a1
Definition
(RefSeq) aldo-keto reductase family 1 member A1
  KO
K00002  alcohol dehydrogenase (NADP+) [EC:1.1.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00040  Pentose and glucuronate interconversions
rno00053  Ascorbate and aldarate metabolism
rno00561  Glycerolipid metabolism
rno00620  Pyruvate metabolism
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
Module
rno_M00014  Glucuronate pathway (uronate pathway)
rno_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    78959 (Akr1a1)
   00040 Pentose and glucuronate interconversions
    78959 (Akr1a1)
   00053 Ascorbate and aldarate metabolism
    78959 (Akr1a1)
   00620 Pyruvate metabolism
    78959 (Akr1a1)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    78959 (Akr1a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    78959 (Akr1a1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.2  alcohol dehydrogenase (NADP+)
     78959 (Akr1a1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   78959 (Akr1a1)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 78959
NCBI-ProteinID: NP_112262
RGD: 68346
Ensembl: ENSRNOG00000016727
UniProt: P51635
LinkDB
Position
5
AA seq 325 aa
MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEAL
KESVGAGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFER
GDNPFPKNADGTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRP
AVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEK
HGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIV
PMITVDGKRVPRDAGHPLYPFNDPY
NT seq 978 nt   +upstreamnt  +downstreamnt
atgacggcctccagtgtcctcctgcacactggacagaagatgcctctgattggtctgggg
acatggaagagtgagcctggtcaggtgaaagcagctattaaatatgcccttagcgtaggc
taccgccacattgactgtgcttctgtatatggcaatgaaactgagattggagaggccctg
aaggagagtgtgggagcaggcaaggcagtacctcgagaggagctgtttgtgacctccaag
ctgtggaatactaagcaccaccctgaggatgtagaacctgctgtccggaagacgctggct
gatctgcagctggagtatttggacctctatttgatgcattggccttatgccttcgagcgg
ggagacaatccctttcccaagaatgccgatggaactgtcaaatatgactccactcactat
aaggagacctggaaggctctggaggcactggtggcaaaggggctggtgaaagccttgggc
ttgtccaacttcagcagtcggcagatagatgatgtcctcagtgtggcctcggtgcgccca
gctgtcttgcaggtggaatgccatccatacctggctcaaaatgagctcattgcccactgt
caagcacgaggcttggaggtgacagcttacagccccttgggttcatcggatcgtgcttgg
cgccaccctgatgagccagtcctgcttgaggaaccagttgtcttggcactagctgaaaaa
catggccgatctccagctcagatcttgctcagatggcaggttcagcggaaagtaatctgc
atccccaaaagcatcactccttcccgcatccttcagaacattcaggtatttgatttcacc
tttagtccagaggagatgaagcaattagatgctctgaacaaaaattggcggtatattgtg
cccatgattacggtggatgggaagagagtccccagagatgctggacaccctctgtatccc
tttaatgacccatactga

DBGET integrated database retrieval system