KEGG   Rattus norvegicus (rat): 85426
Entry
85426             CDS       T01003                                 
Symbol
Slc5a7
Name
(RefSeq) high affinity choline transporter 1
  KO
K14387  solute carrier family 5 (high affinity choline transporter), member 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04725  Cholinergic synapse
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    85426 (Slc5a7)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    85426 (Slc5a7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    85426 (Slc5a7)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC5: Sodium glucose cotransporter
   85426 (Slc5a7)
SSDB
Motif
Pfam: SSF
Other DBs
NCBI-GeneID: 85426
NCBI-ProteinID: NP_445973
RGD: 69270
Ensembl: ENSRNOG00000010597
UniProt: Q9JMD7
LinkDB
Position
9:complement(7595440..7626258)
AA seq 580 aa
MPFHVEGLVAIILFYLLIFLVGIWAAWKTKNSGNAEERSEAIIVGGRDIGLLVGGFTMTA
TWVGGGYINGTAEAVYGPGCGLAWAQAPIGYSLSLILGGLFFAKPMRSKGYVTMLDPFQQ
IYGKRMGGLLFIPALMGEMFWAAAIFSALGATISVIIDVDVNISVIVSALIAILYTLVGG
LYSVAYTDVVQLFCIFIGLWISVPFALSHPAVTDIGFTAVHAKYQSPWLGTIESIEVYTW
LDNFLLLMLGGIPWQAYFQRVLSSSSATYAQVLSFLAAFGCLVMALPAICIGAIGASTDW
NQTAYGFPDPKTKEEADMILPIVLQYLCPVYISFFGLGAVSAAVMSSADSSILSASSMFA
RNIYQLSFRQNASDKEIVWVMRITVFVFGASATAMALLTKTVYGLWYLSSDLVYIIIFPQ
LLCVLFIKGTNTYGAVAGYIFGLFLRITGGEPYLYLQPLIFYPGYYPDKNGIYNQRFPFK
TLSMVTSFFTNICVSYLAKYLFESGTLPPKLDIFDAVVSRHSEENMDKTILVRNENIKLN
ELAPVKPRQSLTLSSTFTNKEALLDVDSSPEGSGTEDNLQ
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgcctttccatgtagaaggactagtagcgattatcctgttctaccttcttatatttctg
gttggaatatgggctgcatggaaaaccaaaaacagcggtaatgcagaagaacgcagcgaa
gccatcatagttgggggccgagacattggtttgttggttggtggttttaccatgacagcc
acctgggttggaggaggttacatcaacgggacagctgaagcagtttatgggccaggttgt
ggtctagcttgggctcaggcacccattggatattctctgagtctgattttaggtggcctg
ttttttgcaaaacctatgcgttctaagggatatgtgactatgttagacccgtttcaacag
atctatggaaagcgcatgggtgggctgctgttcatccctgcactgatgggagagatgttc
tgggctgcagcgattttctctgcattaggggctaccatcagcgtaatcattgatgtggat
gtgaacatatcggtcattgtctccgcactcattgccattctttataccctcgtgggaggg
ctctactctgtggcatatactgatgttgtacagctattctgcatttttataggattgtgg
atcagtgtcccatttgccctgtcacatcctgcagtcaccgacattggattcactgctgtg
catgctaaataccagagtccctggctgggaaccattgaatcaattgaagtctacacctgg
cttgataattttctgttgttgatgctgggtggaataccatggcaagcctacttccagagg
gtcctctcttcatcgtcagcgacctatgctcaggtgctgtccttcctggcagcttttggg
tgcctggtgatggctctaccagccatatgcattggggccattggagcctccacagactgg
aaccaaactgcatatgggtttccagatcccaagaccaaggaggaagcagacatgattctc
ccgattgttctacagtacctctgccctgtgtacatttccttctttgggcttggtgctgtt
tctgctgctgtcatgtcctcggctgactcatccatcctatcagcaagttccatgtttgct
cggaatatctaccagctttccttcagacaaaatgcatcagacaaggaaattgtgtgggtc
atgaggatcactgtgtttgtgtttggagcatctgcaacagccatggccttgctcacgaag
actgtgtatgggctctggtacctgagctctgaccttgtctacatcatcatcttcccacag
ctgctctgtgtactcttcatcaaaggaaccaacacttatggggcagttgctggttatatt
tttggacttttcctgagaattaccggaggagagccatatctatacttgcagcccttaatc
ttctaccctggttattaccctgacaagaatggtatatacaatcagaggttcccatttaaa
actctctccatggttacctcattctttaccaacatttgtgtttcctatctagccaagtat
ctatttgaaagtggaaccttgcctccaaaattagatatatttgatgctgttgtctcaagg
cacagtgaagagaacatggacaagaccattctagtcagaaatgaaaacatcaaattaaat
gaacttgcacctgtaaagcctcgacagagcctaaccctcagttcaactttcaccaataaa
gaggctctccttgatgttgattccagtccagagggatctgggactgaagataacttacaa
tga

DBGET integrated database retrieval system