Rattus norvegicus (rat): 94201 Help Entry 94201             CDS       T01003                                  Symbol Cdk4 Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism rno  Rattus norvegicus (rat) Pathway rno01522   Endocrine resistance rno04110   Cell cycle rno04115   p53 signaling pathway rno04151   PI3K-Akt signaling pathway rno04218   Cellular senescence rno04530   Tight junction rno04660   T cell receptor signaling pathway rno04933   AGE-RAGE signaling pathway in diabetic complications rno04934   Cushing syndrome rno05160   Hepatitis C rno05162   Measles rno05163   Human cytomegalovirus infection rno05164   Influenza A rno05165   Human papillomavirus infection rno05166   Human T-cell leukemia virus 1 infection rno05167   Kaposi sarcoma-associated herpesvirus infection rno05169   Epstein-Barr virus infection rno05200   Pathways in cancer rno05203   Viral carcinogenesis rno05212   Pancreatic cancer rno05214   Glioma rno05218   Melanoma rno05219   Bladder cancer rno05220   Chronic myeloid leukemia rno05222   Small cell lung cancer rno05223   Non-small cell lung cancer rno05224   Breast cancer rno05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     94201 (Cdk4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     94201 (Cdk4)    04115 p53 signaling pathway     94201 (Cdk4)    04218 Cellular senescence     94201 (Cdk4)   09144 Cellular community - eukaryotes    04530 Tight junction     94201 (Cdk4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     94201 (Cdk4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     94201 (Cdk4)    05203 Viral carcinogenesis     94201 (Cdk4)   09162 Cancer: specific types    05212 Pancreatic cancer     94201 (Cdk4)    05225 Hepatocellular carcinoma     94201 (Cdk4)    05214 Glioma     94201 (Cdk4)    05220 Chronic myeloid leukemia     94201 (Cdk4)    05218 Melanoma     94201 (Cdk4)    05219 Bladder cancer     94201 (Cdk4)    05224 Breast cancer     94201 (Cdk4)    05222 Small cell lung cancer     94201 (Cdk4)    05223 Non-small cell lung cancer     94201 (Cdk4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     94201 (Cdk4)    05160 Hepatitis C     94201 (Cdk4)    05164 Influenza A     94201 (Cdk4)    05162 Measles     94201 (Cdk4)    05163 Human cytomegalovirus infection     94201 (Cdk4)    05167 Kaposi sarcoma-associated herpesvirus infection     94201 (Cdk4)    05169 Epstein-Barr virus infection     94201 (Cdk4)    05165 Human papillomavirus infection     94201 (Cdk4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     94201 (Cdk4)    04934 Cushing syndrome     94201 (Cdk4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     94201 (Cdk4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:rno01001]     94201 (Cdk4) Enzymes [BR:rno01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      94201 (Cdk4) Protein kinases [BR:rno01001]  Serine/threonine kinases: CMGC group   CDK family    94201 (Cdk4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase ABC1 Kdo Kinase-like Motif Other DBs NCBI-GeneID:  94201 NCBI-ProteinID:  NP_446045 RGD:  621120 Ensembl:  ENSRNOG00000025602 UniProt:  P35426 LinkDB All DBs Position 7:62885647..62889562 Genome browser AA seq 303 aa AA seqDB search MATTRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAAGGGLPVSTVREVALL RRLEAFEHPNVVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDL MRQFLSGLDFLHANCIVHRDLKPENILVTSNGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR EVSLPRGAFSPRGPRPVQSVVPEMEESGAQLLLEMLTFNPLKRISAFRALQHSYLHKEES DPE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atggctaccactcgatatgaacccgtggctgaaattggtgtcggtgcctatgggacggtg tacaaagcccgagatccccacagtggccactttgtggctctcaagagtgtgagagttcct aatggaggagcagctggagggggccttcccgtcagcacagttcgtgaggtggccttgtta agaaggctggaggcctttgaacatcccaatgttgtacggctgatggatgtctgtgctact tcccgaactgatcgggacatcaaggtcaccttagtgtttgagcatatagaccaggaccta cggacatacctggacaaagcacctccgccgggcttgcctgttgagaccattaaggatctg atgcgccagtttctaagcggcctagatttccttcatgcaaactgcattgttcaccgggac ctgaagccagagaacattctagtgacaagtaatgggacagttaagctggccgactttggc ctagccagaatctacagctaccagatggccctcacgcctgtggttgttacgctctggtac cgggctcctgaagttcttctgcagtctacatatgcaacgcctgtggatatgtggagtgtt ggctgtatcttcgcagagatgtttcgccggaagcctctcttctgtgggaactctgaggct gaccagctgggcaaaatctttgatctcattggattgcctccagaagacgactggcctcga gaggtctctcttcctcgaggagccttttcccccagaggacctcggccagtgcagtcagtg gtgccggagatggaggaatctggagcgcagttgctgctggaaatgctgacctttaatcca cttaagcgaatctctgccttccgagccctgcagcactcttacctgcacaaggaggaaagt gacccggagtga

DBGET integrated database retrieval system