KEGG   Rhodococcus opacus PD630: Pd630_LPD01827
Entry
Pd630_LPD01827    CDS       T03071                                 

Definition
(GenBank) Putative amidase
  KO
K19795  ureidomalonase [EC:3.5.1.95]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa00240  Pyrimidine metabolism
roa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:roa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Pd630_LPD01827
Enzymes [BR:roa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.95  N-malonylurea hydrolase
     Pd630_LPD01827
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-ProteinID: AHK29056
LinkDB
Position
1917403..1918905
AA seq 500 aa
MSHVIDPVTVGDSGPRTGPSCQPREYGELVMCDALTLSSAIKSRQVSCIDVMTAYLDHIE
LHNRSVNAIVALRDRDQLLAEARERDRQLADGHYLGWMHGFPHAVKDLSAVKGLPFTSGS
PIFADRIADADELFVTRIRAAGAIIIGKTNTPEFGLGSQTYNPVWGTTATPYDTSRTAGG
SSGGAAAALALRMVPVADGSDYMGSLRNPPAFNNVVGFRPSWGRIPEAGFIAQGAVVGPM
GRSVADVTHLLSTMAGPDANAPLGIDEDPEVFTRSLERDFSGTRIAWVGDWGGYLATEPG
VLELCESAFEAFGNIGCRVEAALPDYKPEDIWQLFLRWRWWAQLGLVDLYNDAQTRAQMK
PEFVWEMEHGLALSALDVTRAAAARNDWQAAVTKMFDTYDYILAPSAQVFPFDKATHWPT
TIAGRPMDTYHRWMETVAPWTMASLPVAAMPVGFDDRGLPMGIQIIGRHGADRAVLQLAH
AYEQATKWVERVLPPSLLPD
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgtcacacgtcatcgaccccgtcaccgtcggcgattccggccctcgcacgggaccctcg
tgccagccgcgcgaatacggagagctcgtcatgtgtgacgcgctgacgctcagtagtgcg
atcaagagccgccaggtgtcgtgcatcgacgtcatgaccgcctatctcgaccacatcgaa
ttgcacaatcgcagtgtcaacgccatcgtcgccctgcgtgaccgggaccagttgctggcc
gaggcgcgcgagcgggaccgccaactggccgacgggcactacctcggctggatgcacggg
ttcccgcacgccgtcaaggacctctccgcggtcaagggcctaccgttcacctccggatcg
cccatctttgccgaccggatcgccgacgcggacgaactgttcgtcacccggatcagggca
gccggtgccatcatcatcggcaagaccaacacccccgagttcggactcggatcccaaacc
tacaacccggtctggggcacgacggcgacaccgtacgacacctcccgcaccgccggtgga
agcagcggcggcgctgctgcggccctggcgttgcggatggttccggtcgccgacggcagc
gactacatgggctccctgcgcaatccaccggccttcaacaacgttgtgggctttcgcccg
tcgtggggccgcatccccgaggccggattcatcgcgcagggcgcagttgtcggtccgatg
ggacggtcggtcgctgatgtgacgcacctgctctccacgatggcgggtcccgacgccaac
gccccgctgggcatcgacgaggaccccgaggtattcacccggagcctcgaacgtgacttc
agcgggacgcggatcgcatgggtaggggactggggcgggtacctggcgacggaacccgga
gtcctcgaactgtgcgagtccgcattcgaggcgttcgggaacatcggttgccgcgtcgag
gcggcgctccccgactacaagcccgaggacatttggcagctgtttctgaggtggcgctgg
tgggcgcaactcggcttggtcgacctctacaacgacgcgcagacacgcgcgcagatgaag
cccgagttcgtgtgggagatggagcacggactcgctctctccgcgctcgacgtcaccagg
gctgcggcggcacgcaacgactggcaggcggccgtcacgaagatgttcgacacatatgac
tacatcctcgcgcccagtgcgcaggtgtttccgttcgacaaggccacacactggcccacg
acgatcgcgggccggccgatggatacctatcaccggtggatggagaccgtcgcaccgtgg
acgatggcgagtcttccggttgctgcgatgccggtcggtttcgatgaccgcgggcttccc
atgggaatacagatcattggacgacacggcgcagaccgggccgttctccaactcgcccac
gcgtacgagcaggcaacgaagtgggtggagcgtgtgcttccgccctcgctcctcccggac
tga

DBGET integrated database retrieval system