Rossellomorea sp. DA94: P8596_10725 Help Entry P8596_10725       CDS       T10138                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism rod  Rossellomorea sp. DA94 Pathway rod02024   Quorum sensing rod03018   RNA degradation Brite KEGG Orthology (KO) [BR:rod00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     P8596_10725 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     P8596_10725 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:rod03019]     P8596_10725 (hfq)    03036 Chromosome and associated proteins [BR:rod03036]     P8596_10725 (hfq) Messenger RNA biogenesis [BR:rod03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      P8596_10725 (hfq) Chromosome and associated proteins [BR:rod03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     P8596_10725 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  WGG47641 LinkDB All DBs Position 2078051..2078284 Genome browser AA seq 77 aa AA seqDB search MKQSINIQDQFLNQLRKDGSLVTVFLLNGFQIRGQVKGFDNFTVLFETEGKQQLVYKHAI STFAPQRNVQINFEEQN NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgaaacaatccattaatatccaagatcaattcctaaatcaattgcgaaaagacggttca ctcgtaacggtattccttttaaatggcttccagattcgcggtcaggtaaaggggtttgat aattttaccgtcctttttgaaacagaaggtaaacagcaactggtatataaacatgccatt tcaacattcgccccgcagcgaaatgttcaaataaattttgaagaacaaaattaa

DBGET integrated database retrieval system