KEGG   Rhodococcus opacus B4: ROP_27980
Entry
ROP_27980         CDS       T00882                                 

Definition
(GenBank) putative amidase
  KO
K19795  ureidomalonase [EC:3.5.1.95]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00240  Pyrimidine metabolism
rop01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rop00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    ROP_27980
Enzymes [BR:rop01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.95  N-malonylurea hydrolase
     ROP_27980
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-ProteinID: BAH51045
NITE: ROP_27980
UniProt: C1B5B9
LinkDB
Position
complement(3012620..3014095)
AA seq 491 aa
MSHAIDLVNADDSGKTFDDLVMCDALTLSSLIKSREVSCVDVMTAYLDHIELHNRSVNAI
VALRDRGELLAEARERDQQLADGHYLGWMHGFPHAVKDLSAAKGLPFTSGSPIFADRIAD
ADELFVTRIKAAGAIVIGKTNTPEFGLGSQTYNPVWGTTATPYDTSRTAGGSSGGAAAAL
ALRMLPVADGSDYMGSLRNPPAFNNVVGFRPSWGRIPEPGFIAQGAVVGPMGRSVADVAQ
LLSTMAGPAANAPLGIDEDPGVFTRNLERDFRGTRIAWVGDWDGYLATEPGVLELCESSF
DAFRTIGCRVEAALPDYRPEDIWQLFLRWRWWAQLGLVDLYDDPRTRAQMKPEFVWEMEH
GIALSALDVTKAAAARNDWQAALTKMFETYDYILAPSAQVFPFDKSTHWPTEIAGRPMDT
YHRWMETVAPWTMTSLPVAAMPVGFDVRGLPMGIQIIGRHGTDRDVLQLAHAYEQMTKWT
ERVLPPVFRSS
NT seq 1476 nt   +upstreamnt  +downstreamnt
gtgtcacacgccatcgaccttgtcaacgcagacgactccggcaaaactttcgacgacctc
gtcatgtgcgatgcgttgaccctcagtagcttgatcaagagtcgcgaagtgtcgtgcgtc
gacgtcatgacagcctatctcgaccacatcgaactgcacaatcgcagcgtcaacgccatt
gtcgccctgcgcgatcggggcgagttgctggccgaggcgcgcgagcgggaccaacagctc
gccgacgggcactacctcggctggatgcacgggttcccgcacgccgtcaaggacctctcc
gccgccaaggggcttccgttcacctccggatcacccattttcgccgatcggatcgccgat
gcggacgagctgttcgtcacgcggatcaaggccgcgggcgccattgtcatcggcaagacc
aacacccccgagttcgggctcgggtcccaaacgtacaacccggtgtgggggacgacggcg
acaccgtacgacacgtcacgcaccgcgggtggaagcagtggcggtgccgccgcggccctg
gcactgcggatgctcccggtcgccgacggcagcgactacatgggttcgctgcgaaacccg
cccgccttcaacaatgtcgtgggatttcggccgtcgtgggggcgcattccggagccaggc
ttcatcgcgcagggcgcggttgtcggcccgatgggtcggtcggtggccgatgtggcgcag
ctcttgtcgacgatggcggggcccgccgccaacgccccgctcggcatcgacgaggacccc
ggggtattcacacggaacctcgagcgggacttccgcggaacgcggatcgcctgggtgggg
gactgggacgggtacctggcgacggaacccggagttctcgaactctgcgagtcctcgttc
gacgcgttccggaccatcggttgccgcgtcgaggcagcgctccccgactaccggcccgaa
gacatctggcagctctttctgcgatggcgctggtgggcccagctcggcttggtcgacctc
tacgacgaccctcggacacgtgcgcagatgaagcccgaattcgtgtgggagatggagcac
ggaatcgcactgtccgcactcgacgtcaccaaggcagcggcagcccgcaacgactggcag
gcggccctcacgaagatgttcgaaacatatgactacatcctcgcgcccagtgctcaggta
tttccgttcgacaagtccacgcactggcccaccgagatcgccggcagacccatggatacg
tatcaccgatggatggagaccgtcgcgccgtggacgatgacgagcctcccggttgcggcg
atgccggtcgggttcgatgtccgcgggctcccgatgggaattcagataatcggacggcac
ggcactgaccgggacgttctccaactcgcccacgcgtacgagcagatgacgaagtggacg
gagcgtgtgcttccgccggtattccgttcgagctga

DBGET integrated database retrieval system