KEGG   Rhodococcus oxybenzonivorans: CBI38_14145
Entry
CBI38_14145       CDS       T08279                                 
Name
(GenBank) benzene 1,2-dioxygenase
  KO
K08689  biphenyl 2,3-dioxygenase subunit alpha [EC:1.14.12.18]
Organism
roz  Rhodococcus oxybenzonivorans
Pathway
roz00621  Dioxin degradation
roz01100  Metabolic pathways
roz01120  Microbial metabolism in diverse environments
roz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:roz00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    CBI38_14145
Enzymes [BR:roz01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.18  biphenyl 2,3-dioxygenase
     CBI38_14145
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: AWK72536
UniProt: A0A2S2BV56
LinkDB
Position
3009129..3010508
AA seq 459 aa
MTEPNCGPTLTKDKPRWADEDIAALVDEKNGRIDPQIFTDEAIYEQELERVFARSWLMMG
HETQIPNAGDFMTNYMGEDPVIVARQKDGSIRVFLNQCRHRGMRICRADGGNAKSLTCSY
HGWAYDMAGNLVSVPMQKEAFPNLKKEEWGPLKARVETYKGLIFANWDADAPDLETYLGD
AKFYMDHMLDRTEAGTEAIPGVQKWVIPCNWKLAAEQFASDMYHAATTAHLSGILAGLPE
HIDISQVAPPTTGIQYRAPWGGHGTGFYINDPALLLAITGPKIAQYNTQGPAADKAVERL
GSIVRGSQVTAEHMTIFPNCSFLPGLNTVRSWHPRGPNEIEVWAFTIVDADAPEDIKDEF
RIQSMRSFSAGGVFEQDDGENWVEIQQVLRGHMARSRPFNAEMGLGETRTDADYPGTISN
VYSEEAARGLYSHWVRMMTSPDWAALNATRIPQDEAALT
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgactgaaccgaactgtggacctacgctgacgaaggacaagccgagatgggccgatgag
gacatcgcggcgctcgtcgacgagaagaacggccggatcgatccccaaatcttcaccgac
gaggccatctacgagcaggagttggagcgcgtattcgctcgctcgtggttgatgatgggc
cacgagacccagattccgaacgctggcgacttcatgacgaactacatgggtgaagacccg
gtgatcgtcgctcgtcagaaggatggaagcattcgcgtcttcctcaaccagtgccgccat
cgcggaatgcgcatctgccgcgctgacgggggcaacgcgaagtcgctgacctgcagctac
cacggctgggcatacgacatggccggcaacttggtgagcgtgccgatgcagaaggaagcc
ttccccaatctcaagaaggaagagtggggtccactcaaagctcgagtggaaacctacaag
ggcctcattttcgccaactgggacgccgacgcccctgacctcgagacctacttgggcgat
gcgaagttctacatggaccacatgttggaccggaccgaagcgggtaccgaagctatcccg
ggcgttcagaagtgggtcattccgtgcaactggaagttggctgcagaacagttcgccagc
gatatgtatcacgcggcaaccaccgcgcacctttccggaattctggcagggctacccgag
cacatcgacatcagccaggttgcgcccccgacgacgggcatccaataccgtgctccctgg
ggcggccacggcaccgggttctacatcaacgaccccgcgctgcttcttgccatcaccgga
ccgaaaattgcgcagtacaacacccaggggcctgccgccgataaagcggtcgagaggctc
ggaagcatcgtgcgtggttctcaggtgactgcagagcacatgaccatctttccgaactgc
tctttcctgccaggtctgaacaccgtgcggtcatggcatccccgtggcccgaacgagatc
gaagtctgggcgttcaccattgtcgatgccgacgcacccgaggacatcaaggacgaattc
cgtattcagtcgatgcgcagcttctcggccggtggcgtcttcgagcaggatgacggtgag
aactgggtcgagatccagcaggtgctgcgtggtcacatggctcgtagccgcccgttcaat
gcggagatggggctgggcgagactcggacggacgctgactacccggggacgatcagcaac
gtttacagcgaggaagctgcccgcgggctgtactcgcactgggtgcgaatgatgacgtcc
ccggactgggccgccctcaatgccactcgcatcccgcaggacgaagcagcgctcacgtaa

DBGET integrated database retrieval system