KEGG   Rhodococcus oxybenzonivorans: CBI38_30600
Entry
CBI38_30600       CDS       T08279                                 
Name
(GenBank) aromatic ring-hydroxylating dioxygenase subunit alpha
  KO
K11943  PAH dioxygenase large subunit [EC:1.13.11.-]
Organism
roz  Rhodococcus oxybenzonivorans
Pathway
roz00624  Polycyclic aromatic hydrocarbon degradation
roz01100  Metabolic pathways
roz01120  Microbial metabolism in diverse environments
roz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:roz00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    CBI38_30600
Enzymes [BR:roz01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     CBI38_30600
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: AWK75963
UniProt: A0A2S2C575
LinkDB
Position
pRB98:complement(10608..12014)
AA seq 468 aa
MLSNELRQTLQKGLHDVKSDWTVPASIINDPEVHDVERERVFGHAWVFLAHESEIPERGD
YVVRYISEDQFIVCRDEDGEIRGHLNACRHRGMQVCRAEMGNASHFRCPYHGWTYSNTGS
LVGVPAGKDAYGNQLKKSDWNLRPMPNLATYKGLIFGSLDPNADSLEDYLGDMKFYLDIV
LDRSDAGLQVVGAPQRWVVDANWKLGADNFVGDAYHTMMTHRSMVELGLAPPDPQFALYG
EHVHTEHGHGLGIIGPPPGMPLPEFMGMPENIVEEMGRRLTPEQVEIFRPNAFIHGTVFP
NLSIGNFLMAKDHLSPPTPFLTLRLWHPLGPDKMEVMSFFLVEKEAPDWFKDESYKAYLR
TFGISGAFEQDDAENWRSITRVLGGQFAKTGELNYQMGRGVLEPDPNWPGPGEAYPLDYA
EANQRNFLEYWMQLMLADTPLHAGNSNSNGKAETSAPAAPKTPAKAEA
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgctgagcaacgaactccggcagaccctccagaagggtttgcacgacgtgaagtccgac
tggaccgtccccgcctcgatcatcaacgatcccgaggtgcacgacgtcgagcgcgagcgg
gtcttcggtcacgcgtgggtctttctcgcgcacgagagtgagatccccgagcgcggcgat
tacgtcgtgcggtacatctccgaggatcagttcatcgtctgccgcgacgaggacggcgaa
atccgcgggcacctcaacgcttgccgccaccgcggtatgcaggtgtgccgcgcggagatg
gggaacgcctcgcacttccggtgcccgtaccacggctggacctacagcaacacgggaagt
ctggtcggcgtgccggccggcaaggacgcgtacggcaatcagctgaagaagtccgactgg
aacctgcggccgatgccgaacctggccacctacaagggcctgatcttcggctcgctggac
ccgaacgccgattcgctggaggactacctcggcgatatgaagttctacctcgatattgtt
ctggaccgcagtgacgccgggctgcaggtcgtcggcgccccgcagcggtgggtggtcgac
gcgaactggaagctcggcgcagacaacttcgtcggcgacgcctaccacaccatgatgacc
caccgctcgatggtcgagctggggctcgccccgcccgacccgcagttcgcgctctacgga
gagcacgtccacaccgagcacggtcacggcctgggcatcatcggtccgccgccgggtatg
ccgctgccggagttcatgggcatgccggagaacatcgtcgaggaaatggggcgtcggctc
acgccggagcaggtcgagatcttccggcccaatgccttcatccatggcaccgtgttcccg
aatctgtcgatcggcaacttcctgatggccaaggatcacctctccccgccgacgccgttc
ctgacgctgcgcctgtggcacccgctcggaccggacaagatggaggtgatgtcgttcttc
ctcgtcgaaaaggaggcgcccgactggttcaaggacgagagctacaaggcctacctgcgc
accttcgggatctccggcgccttcgaacaggacgacgccgagaactggcgcagtatcacc
cgtgttctgggtggtcagttcgccaagacaggggagctcaactaccagatggggcgcggc
gttctcgagcccgacccgaactggcccggacccggggaggcctacccgctggactacgcc
gaggccaaccagcgcaacttcctcgaatactggatgcagctcatgctcgcggacacaccg
ctgcacgccggcaacagcaacagcaacggcaaggcggagacgtcggcgccggccgccccc
aagaccccagcgaaagcggaggcgtag

DBGET integrated database retrieval system