KEGG   Rhodococcus qingshengii: C1M55_30120
Entry
C1M55_30120       CDS       T05315                                 

Definition
(GenBank) amidase
  KO
K19795  ureidomalonase [EC:3.5.1.95]
Organism
rqi  Rhodococcus qingshengii
Pathway
rqi00240  Pyrimidine metabolism
rqi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rqi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    C1M55_30120
Enzymes [BR:rqi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.95  N-malonylurea hydrolase
     C1M55_30120
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-ProteinID: AUS34951
UniProt: A0A069J983
LinkDB
Position
1:complement(6373127..6374605)
AA seq 492 aa
MVHAADPVDESVSGAPENRELVMADAVTLSGLIRRREVSCVEVMDSFLDQIELHNPAVNA
IVALRDREALTAEARERDSQLASGEYLGWMHGFPHAVKDLSAAKGLPFTSGSPMFADRIA
EDDELFVKRIRSAGAIVIGKTNTPEFGLGSQTYNPVWGTTVSPYDNSRTAGGSSGGAAAS
LALRMLPVADGSDYMGSLRNPSAFNNVVGFRPSWGRIPETGFIAQGAVVGPMGRTVTDVA
HLLSTMAGPDAHAPLGIREDPAVFTESLARDLKGSRIAWVGDWNGYLATEPGVLELCESS
FEVFEQLGCRVEAALPDFKPEDIWQLFLRWRWWAQLGLIDQYNDPSLRELMKPELLWELE
HAVTLSALDVTKAAEARNGWLSAITKMFETYDYILAPSAQVFPFDKNTHWPETVDGRSMD
TYHRWMETVVPWTMAGVPVAGMPVGFDDRSLPMGIQIIGRHGADLDVLQLAYAFEQATQW
VERVLPPALRVN
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggttcatgctgctgaccctgtcgacgagagcgtttccggtgcgcccgagaatcgcgaa
ctcgtcatggccgatgcggtcacgctcagtggtctgatacgcaggcgtgaagtgtcgtgt
gtcgaggtgatggacagcttcctcgatcagatcgaattacataacccggcggtgaacgcg
atcgtcgcattgcgggatcgggaagcgttgacggcggaggcgcgcgagcgtgattcgcag
ttggcgagtggggagtatctcggttggatgcacgggtttccgcatgcggtgaaggatctt
tcggcagccaagggtctgccgttcacgtccgggtcgccgatgttcgcggatcgaatcgcc
gaagatgacgaactgttcgtcaagcggatcaggtctgccggtgccattgtgatcggcaag
acgaacacaccggagttcggactcggatcccagacgtacaacccggtgtggggtacgacg
gtgtcgccgtacgacaattcgcgcactgccggcggtagcagcggtggcgccgcagcgtcg
ttggcgctccgcatgttgccggtggctgatggaagcgattacatgggttcgctccgaaac
ccgtcggcattcaacaacgttgttgggtttcgaccatcctggggtcggataccggagacg
ggattcatcgctcagggcgccgttgtgggcccgatgggccgaaccgtcaccgacgtggct
cacctgctttccacgatggcggggccggatgctcatgcaccgttggggattcgtgaggat
cccgcggtattcaccgaaagcctcgcacgtgatctgaagggctctcggatcgcatgggtc
ggtgactggaacggttacctggcaaccgaacctggagttctcgagttgtgcgaatcctcg
ttcgaggtcttcgaacagttggggtgccgcgtcgaggcggcgcttcccgacttcaaaccc
gaggacatctggcaactgttcttgcggtggcgttggtgggcacagctcggcttgatcgat
cagtacaacgatccgagcttgcgcgagttgatgaagcccgaactgttgtgggaactcgag
cacgcggtcacactgtcggctctcgacgtgaccaaggccgcggaggcccgcaacggctgg
ctgtcggccattaccaagatgttcgaaacctacgactacattcttgcgcccagtgcccag
gtgtttcctttcgacaagaacactcactggcccgagaccgtcgacggccgatcgatggac
acgtatcaccggtggatggagacggttgttccctggacgatggccggggttccggttgcg
gggatgccggtcggcttcgacgatcgttcgcttcccatgggtatccagatcatcggtcgg
cacggagccgacttggacgtactccaactcgcctacgcattcgagcaggcaacccagtgg
gtcgagcgggttcttccgcccgcactccgcgtgaactga

DBGET integrated database retrieval system