KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104672095
Entry
104672095         CDS       T03989                                 
Name
(RefSeq) cytochrome P450 3A5 isoform X1
  KO
K17690  cytochrome P450 family 3 subfamily A5 [EC:1.14.14.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00140  Steroid hormone biosynthesis
rro00830  Retinol metabolism
rro00980  Metabolism of xenobiotics by cytochrome P450
rro00982  Drug metabolism - cytochrome P450
rro01100  Metabolic pathways
rro05204  Chemical carcinogenesis - DNA adducts
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    104672095
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    104672095
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    104672095
   00982 Drug metabolism - cytochrome P450
    104672095
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    104672095
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:rro00199]
    104672095
Enzymes [BR:rro01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     104672095
Cytochrome P450 [BR:rro00199]
 Cytochrome P450, animal type
  CYP3 family
   104672095
SSDB
Motif
Pfam: p450 Coa1
Other DBs
NCBI-GeneID: 104672095
NCBI-ProteinID: XP_010374099
UniProt: A0A2K6PIX0
LinkDB
Position
6:46369411..46395953
AA seq 433 aa
MWRTQDGQLPVLTITDPDMIKTVLVKECYSVFTNRRPLGPVGLMKSAISIAEDEEWKRIR
SLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKGKPVTLKDIFGAYSMDVITGTSFG
VNIDSLNNPKDPFVESIKKFLKFDILDPLFLSIVLFPFLTPAFEALNVSLFPKDAMNFLS
KSVNRMKKSRLNDKQKHRVDFLQLMIDSQNSKEIESHKALSDQELVAQSIIFIFAGYETT
SSVLSFTIYELATHPDVQQKLQKEIDAVLPNKAPATYDAMVQMEYLDMVVNETLRLFPIA
IRLERVCKKDVEINGVFIPKGAMVVIPTYALHHDPKYWTEPEEFRPERFSKKNKDSIDPY
IYTPFGTGPRNCIGMRFALMNMKLALIKVLQNFSFKPCKETQIPLKLGNQGLLQSEKPIV
LKVESRDGTLSGE
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgtggagaacgcaagatggtcaactccctgtgctgaccatcacagatcccgacatgatc
aaaacagtgctagtgaaagaatgttattctgtcttcacaaatcgaaggcccttaggtcca
gtgggacttatgaaaagtgccatctctatagctgaggatgaagaatggaagagaatacgg
tcattgctgtctccaaccttcaccagcggaaaactcaaggagatgttccccatcattgcc
cagtatggagatgtgttggtgagaaacttgaggcgggaagcagagaaaggcaagcctgtc
accttgaaagacatctttggggcctacagcatggatgtgatcactggcacatcatttgga
gtgaacatcgactctctcaacaatccaaaagacccttttgtggaaagcattaagaagttc
ctaaaatttgatatcttagatccattatttctctcaatagtactctttccattccttacc
ccagcttttgaagcattaaatgtctctctgtttccaaaagatgccatgaattttttaagt
aaatctgtaaacagaatgaaaaaaagtcgcctcaacgacaaacaaaagcaccgagtagat
ttccttcagctgatgattgactctcagaattcaaaagaaattgagtcccacaaagctctg
tctgatcaggagctcgtggcccaatcaattatcttcatttttgctggctatgaaaccacc
agcagtgttctttccttcactatatatgaactggccactcaccctgatgtccagcagaaa
ctgcagaaggagattgatgctgttttgcccaataaggcacctgccacgtacgatgccatg
gtacagatggagtaccttgacatggtagtgaatgaaacactcagattattcccaattgct
attagacttgagagggtctgcaaaaaagacgttgaaatcaatggggtgttcattcccaaa
ggggcaatggtggtgattccaacctatgctcttcaccatgacccaaaatactggacagag
cctgaggagttccgccctgaaaggttcagtaagaagaacaaggacagcatagatccttac
atatacacaccctttggaactggacccagaaactgcattggcatgaggtttgctctcatg
aacatgaaacttgctctaatcaaagtccttcagaacttctccttcaaaccttgtaaagaa
acacagatccccttgaaattaggcaaccaaggccttcttcaatcagaaaaacccattgtt
ctaaaggttgagtcaagagatggaaccctaagtggagaatga

DBGET integrated database retrieval system