KEGG   Cereibacter sphaeroides KD131: RSKD131_3113
Entry
RSKD131_3113      CDS       T00844                                 

Name
(GenBank) Cobalamin B12-binding domain protein
  KO
K20907  2-hydroxyisobutanoyl-CoA mutase small subunit [EC:5.4.99.64]
Organism
rsk  Cereibacter sphaeroides KD131
Brite
KEGG Orthology (KO) [BR:rsk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RSKD131_3113
Enzymes [BR:rsk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.64  2-hydroxyisobutanoyl-CoA mutase
     RSKD131_3113
SSDB
Motif
Pfam: B12-binding Aldolase LpxI_N IMPDH Mut7-C
Other DBs
NCBI-ProteinID: ACM02973
UniProt: B9KVW9
LinkDB
Position
2:11261..11668
AA seq 135 aa
MSTQIRVLLAKVGLDGHDRGVKVVARTLRDAGMDVVYSGLHRTPEEVVTAAVQEDVDILG
VSLLSGVQMTVFPKIFALLKEHKVEDMIVVAGGVMPDEDVIELKKMGVAEVLLQDTPPQH
IIDALTGLVKARGDR
NT seq 408 nt   +upstreamnt  +downstreamnt
atgtcgacccagatccgtgtgctgctcgcgaaggttggcctcgatggccacgaccgcggt
gtgaaggtggtggcccgcaccctgcgcgatgccgggatggatgtggtctattccggtctc
catcgcaccccggaggaggtggtgacggccgcggtgcaggaggatgtggacatcctcggc
gtcagcctcctgtcgggcgtgcagatgacggtctttccgaagatcttcgcgctgctgaag
gagcacaaggtcgaggacatgatcgtggtcgcggggggcgtcatgcccgacgaggatgtg
atcgagctgaagaagatgggcgtggccgaggtgctgctgcaggacacgccgccccagcac
atcatcgacgccctcacgggtctggtgaaggcgcggggagaccgctga

DBGET integrated database retrieval system