KEGG   Ralstonia solanacearum CMR15: CMR15_10813
Entry
CMR15_10813       CDS       T02725                                 

Symbol
aac
Name
(GenBank) acyl-homoserine lactone acylase transmembrane protein (Glutaryl-7-aminocephalosporanic-acid acylase)
  KO
K07116  acyl-homoserine-lactone acylase [EC:3.5.1.97]
Organism
rsm  Ralstonia solanacearum CMR15
Brite
KEGG Orthology (KO) [BR:rsm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CMR15_10813 (aac)
Enzymes [BR:rsm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.97  acyl-homoserine-lactone acylase
     CMR15_10813 (aac)
SSDB
Motif
Pfam: Penicil_amidase
Other DBs
NCBI-ProteinID: CBJ37020
UniProt: D8N7J6
LinkDB
Position
complement(866688..869075)
AA seq 795 aa
MTHGFARRNTLAMATLAALAGCAGTAHGSRWDTPSDTGLSAEIRRTGFGIPHIRANDYAS
LGFGMAYAYAQDNLCLLADQVVTVNGERAKTFGPDGTATVAFKTIPNPRSDAFFKGIVDA
TALRDGYARMSPEARELLRGYIAGYNRYLKDTPPASFPAACRNAAWVRPLTLADVMLMGE
EKAIQASAGAMLAGIVDAQPPGRTHVSDTQPPPHDVDVAALDRELRLRDLPIGSNGWAFG
SAATENRRGALLGNPHFPWTTTNRFYELHLTVPGKLDVMGASIAAFPVVSIGFNRDVAWT
HTVSTGSRFTLFELRLADGDPTTYLVDGTPHKMTARTVAFDVKLPDGRIEHRAHTFYDTE
YGPVVSMPAAGMPWTTQKAYALRDANRGNTRMIDAWLRVGQAGDVAGIHRALGNLGIPWV
NTIAADRNGRALFVDVSATPDVSAEMLKRCAPSPLAERLFKDAGLVLLDGARSTCNWQVD
PASPVPGLIAPARMPALERDDFVANSNDSSWLTNPAQKLTGFPPIMGETDVPQRLRTRIG
LIEIGRRLAGTDGLPGNRIDLPNLQAMLFRNTNLAAHLVLGDLLEACRAARDADADVRNG
CVALGRWNRTDAANARAAHLFREFWMRAQDIAQVYATDFNPADPIYTPRGLRMHDAAVRA
AVFKALKDAVGAVRAAGFALDAPLGTVQAVRRPDGDIPLHGGEEYEGVLNKLQSLPIGPQ
GLQVDEGTSYVQTVGFDAQGPIAQALLVYGESTDPASPHAFDQMRAFSAKRWIRLPFSET
AIAADPALKVTKLSQ
NT seq 2388 nt   +upstreamnt  +downstreamnt
atgacgcacggattcgcacggcgcaacacgctcgccatggccacgctcgcagcgctggcc
ggctgcgcgggcacggcgcacggcagccgttgggacacgccgtccgacaccggcctgtcg
gccgagatccgccgcaccggcttcggcattccgcacatccgcgccaacgattacgccagc
ctcggcttcggcatggcctatgcctatgcgcaggacaatctctgcctgctcgccgaccag
gtcgtcaccgtcaacggcgagcgcgcgaagacgttcgggccggacggcaccgccaccgtg
gcgttcaagaccatccccaacccccgctcggatgcgttcttcaagggcatcgtcgacgcg
accgcgctgcgtgacggctatgcgcggatgtcgcccgaggcgcgcgaactgctgcgcggc
tacatcgccggctacaaccgctacctgaaggacaccccgccggccagcttccccgccgca
tgccgcaacgccgcctgggtgcgcccgctcacgctggccgacgtgatgctcatgggcgag
gagaaggcgatccaggccagcgccggcgcgatgctggccggcatcgtcgatgcgcagccg
ccgggccggacgcacgtgtccgatacgcagcccccgccgcacgacgtcgatgtcgccgcg
ctcgaccgcgagctgcggctgcgcgacctgcccatcggcagcaacggctgggccttcggc
agtgccgccacggagaaccggcgcggcgcgctgctcggcaacccgcacttcccgtggacg
accaccaaccgcttctacgaactccacctgaccgtgcccggcaagctcgacgtgatgggc
gcgtcgatcgccgccttccccgtcgtcagcatcggcttcaaccgcgacgtggcgtggacc
cacacggtctccaccggcagccgcttcacgctgttcgagctcaggctggccgacggcgac
cccaccacctatctggtcgacggcacgccgcacaagatgaccgcgcgcacggtcgccttc
gacgtgaagctgcccgacggccgcatcgagcaccgcgcgcacaccttttacgacaccgaa
tacggcccggtggtgtcgatgcccgccgccggcatgccgtggaccacgcagaaggcctac
gcgctgcgcgatgccaaccgcggcaacacgcgcatgatcgacgcctggctgcgcgtcggg
caagccggggatgtggcaggcatccaccgggcgctcggcaacctgggcattccgtgggtc
aacaccatcgccgccgaccgcaacggccgcgcgctgttcgtcgacgtctcggccacgccc
gatgtctcggccgagatgctcaagcgctgtgccccatcgccgctggccgagcggctgttc
aaggacgccggcctggtgctgctggacggcgcgcgcagcacctgcaactggcaggtcgat
ccggcctcgccggtgccggggctgatcgcgcccgcgcgcatgccggcgctcgagcgcgac
gacttcgtcgccaacagcaacgacagttcgtggctgaccaacccggcgcagaagctcacc
ggcttcccgcccatcatgggcgagaccgacgtgccgcagcgcctgcgcacccgcatcggc
ctgatcgagatcggccgccgcctggccggcaccgacggcctgccgggcaaccgcatcgac
ctgccgaacctgcaggcgatgctcttccgcaataccaacctcgccgcccacctggtgctg
ggcgatctgctcgaagcctgcagggccgcgcgcgacgccgatgccgacgtgcgcaacggc
tgcgtcgccctgggccggtggaatcgcaccgacgccgccaatgcccgcgccgcccacctg
ttccgcgagttctggatgcgcgcccaggacattgcgcaggtctacgccaccgacttcaac
ccggccgacccgatctacacgccgcgcggcctgcgcatgcacgacgcggccgtgcgcgcc
gccgtgttcaaggcgctcaaggatgcggtgggcgcggtgcgcgcggccggcttcgcgctg
gatgccccgctcggcaccgtgcaggcggtgcgccggccggacggcgacatcccgctgcat
ggcggcgaggagtacgaaggcgtgctcaacaaactgcagagcctgccgatcggaccgcaa
ggcctgcaggtcgacgagggcaccagctacgtccagaccgtcggcttcgacgcgcagggc
cccatcgcgcaggccctgctggtctacggcgaatcgaccgacccggcctcgccgcacgcc
ttcgaccagatgcgcgcgttctcggccaagcggtggatccgcctgccgttctcggagacc
gccatcgccgccgatccggcgctgaaggtgacgaagctgtcgcagtga

DBGET integrated database retrieval system