Cereibacter sphaeroides ATCC 17025: Rsph17025_1816 Help Entry Rsph17025_1816    CDS       T00512                                  Name (GenBank) single-strand binding protein   KO K03111   single-strand DNA-binding protein Organism rsq  Cereibacter sphaeroides ATCC 17025 Pathway rsq03030   DNA replication rsq03430   Mismatch repair rsq03440   Homologous recombination Brite KEGG Orthology (KO) [BR:rsq00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     Rsph17025_1816    03430 Mismatch repair     Rsph17025_1816    03440 Homologous recombination     Rsph17025_1816  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:rsq03032]     Rsph17025_1816    03400 DNA repair and recombination proteins [BR:rsq03400]     Rsph17025_1816    03029 Mitochondrial biogenesis [BR:rsq03029]     Rsph17025_1816 DNA replication proteins [BR:rsq03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     Rsph17025_1816 DNA repair and recombination proteins [BR:rsq03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     Other MMR factors      Rsph17025_1816   TLS (translesion DNA synthesis) factors    Other SOS response factors     Rsph17025_1816 Mitochondrial biogenesis [BR:rsq03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA replication factors    Other Mitochondrial DNA replication factors     Rsph17025_1816 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SSB Motif Other DBs NCBI-ProteinID:  ABP70708 UniProt:  A4WTJ4 LinkDB All DBs Position complement(1859334..1859732) Genome browser AA seq 132 aa AA seqDB search MAGSINKVILIGTLGRDPEVRTFANGGKVVNLRLATSEQWKDKQSGERKERTEWHSVAIT NEPLGRIAEQYLRKGSKVYLEGQLETRKWQDKDGADRYTTEVVLRPFRGELTLLDGRNAA AGAEVEPDAIPF NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atggcaggcagcatcaacaaagtcatcctcatcggcacgctgggccgcgacccggaagtc cggacgttcgcgaacggcggcaaagtcgtgaacctccgcctcgccacctcggaacagtgg aaggacaagcagtccggcgagcgcaaagagcggaccgaatggcactccgtcgcgatcacg aacgagccgctgggccggatcgccgagcagtatctgcgcaagggctcgaaggtctatctc gaaggccagctcgagacccgcaagtggcaggacaaggacggcgctgaccgctacacgacc gaagtcgtccttcgcccgttccgcggcgagctgacactcctcgatggccgcaatgccgct gccggcgcggaggtcgagcccgacgcaatcccgttttga

DBGET integrated database retrieval system