KEGG   Raphanus sativus (radish): 108814527
Entry
108814527         CDS       T06014                                 
Name
(RefSeq) cytosolic sulfotransferase 16-like
  KO
K11821  aromatic desulfoglucosinolate sulfotransferase [EC:2.8.2.24]
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz00380  Tryptophan metabolism
rsz00966  Glucosinolate biosynthesis
rsz01100  Metabolic pathways
rsz01110  Biosynthesis of secondary metabolites
rsz01210  2-Oxocarboxylic acid metabolism
Module
rsz_M00370  Glucosinolate biosynthesis, tryptophan => glucobrassicin
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    108814527
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    108814527
Enzymes [BR:rsz01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.24  aromatic desulfoglucosinolate sulfotransferase
     108814527
SSDB
Motif
Pfam: Sulfotransfer_1 Sulfotransfer_3 TSNAXIP1_N
Other DBs
NCBI-GeneID: 108814527
NCBI-ProteinID: XP_018442624
UniProt: A0A6J0K6J2
LinkDB
Position
Unknown
AA seq 337 aa
MEPNKTQNGSQVELSEFEKTQKKYQDFISALPKSKGWRPNEILTQHGGHWWQECLLEGLL
HAKDHFQARPTDFLVCSYPKTGTTWLKALTYAIVNRSRFDDAANPLLKRNPHEFVPYVEI
DFAFYPTVDVLQDGKNQLYSTHIPNGSLPESIVKSGCKMVYIWRDPKDTFISMWTFLHKE
KSQEGQLASLEEAFDMFCEGLSVYGPYLDHVLGYWKAYKENPERILFLRYEAMRADPLPF
VKRLAEFMGYGFSAEEEEKGVAENVVKLCSFETLKNLEANKGDKEREDRPAVYANSAYFR
KGKVGDWANYLTPEMAARIDGLVEEKFKDTGLLQHDQ
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggaacccaacaagacccagaacggatcccaagttgagctctcagagttcgaaaagacc
caaaagaagtaccaagatttcatctctgccctcccaaagagcaaaggatggagacccaac
gagatcctaacccaacacggtggacactggtggcaagaatgtctcctagaaggccttctt
cacgccaaagaccatttccaagcacgacccaccgacttcctcgtctgcagctacccgaaa
accggcacgacctggctcaaagccttgacttacgccatcgtaaaccgttcccgcttcgac
gacgccgcgaacccgctcctcaaacgcaaccctcacgagttcgtgccttacgtggagatc
gacttcgctttctacccgaccgtggacgtccttcaagacgggaagaaccagctttactcc
acccatatacccaacggatcactaccagagtccatcgtgaagtcaggttgcaagatggtt
tacatatggagagaccccaaggacactttcatctccatgtggactttcctccacaaggag
aagtctcaagagggtcagctagcgagtctcgaagaggctttcgatatgttctgtgaaggt
ctgtctgtgtacggtccttatctggaccatgtgttgggttactggaaggcttacaaagag
aacccggagaggattctgttccttaggtacgaggcgatgagagctgatcctttgccgttt
gtgaagaggttggctgagttcatggggtatggattcagtgccgaggaagaggagaaaggg
gtcgctgagaatgttgtgaagctttgcagcttcgagacgttgaagaatcttgaagctaac
aaaggagataaggagagggaggatcgccctgcggtttatgcgaacagtgcttattttagg
aaaggaaaggtgggagattgggctaattatctgactccggagatggctgctcgtatcgat
gggttagtggaagagaagttcaaagacactggcttgcttcaacatgatcagtga

DBGET integrated database retrieval system