KEGG   Raphanus sativus (radish): 108821536
Entry
108821536         CDS       T06014                                 
Name
(RefSeq) cystine lyase CORI3-like
  KO
K21623  L-cystine beta-lyase [EC:4.4.1.35]
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz00270  Cysteine and methionine metabolism
rsz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    108821536
Enzymes [BR:rsz01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.35  L-cystine beta-lyase
     108821536
SSDB
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Aminotran_3
Other DBs
NCBI-GeneID: 108821536
NCBI-ProteinID: XP_018450048
UniProt: A0A6J0KR20
LinkDB
Position
Unknown
AA seq 424 aa
MATTPKCTEWQFSGSEAAKEAAAAALGAYTSKLMALCDPNGKPILPPNKKAIETSNSAEK
AVVKVVLSGTGNAYAPSIGLPVAKSAVAEYLNRDLPKKLTADDVFMTVGCKRAIDLAVDI
LAKPKANVLLPRPGFPWDVVRSIYKKLEVRYYDFIPEQNFEIDFESVKKVTDKNTFAIFI
INPHNPNGNTYSEAHLKQLAELAKELSIMVVSDEVFRWTVFGNNPFVPMGKFSSIVPVVT
LGSLSKGWNVPGWRTGWLALHDLDGVFRNTKILEAANEFLQINAKPPTVIQAAMPDILER
TPKHFFLERGSFLKHKVDIGYAKLKHIPGLTCYMKPEACTFLWTKLDISCFADIGDDQEF
CSKLAMEENLVVLPGIAFRQPNWLRHSIDMETPTVEDAFERLKSFCERHSTKGGASLKNA
NGVN
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggcaaccacccccaagtgcactgagtggcagttcagcggtagcgaggcagccaaagaa
gctgctgcggccgccctaggtgcctacacctctaaactcatggctctttgtgatcctaat
ggcaagcccattttgcccccaaacaaaaaggccatagagaccagcaattcagccgaaaaa
gctgtcgttaaagttgttctctccggcactggaaacgcctatgctcctagcattggcctt
cccgtcgcaaaaagtgccgtagcagagtatctaaaccgagatcttccgaagaagctaaca
gcagatgacgtgtttatgactgttggatgcaaacgagcgattgaccttgcggtcgatatt
cttgctaaaccaaaagccaacgttctgcttccgaggccaggcttcccatgggatgtagta
cgctccatctacaagaagctcgaggtccgttactatgattttatccctgaacaaaacttt
gagatcgacttcgaaagcgtcaaaaaggtgacagacaagaacacgtttgctatatttatc
atcaaccctcacaatcccaatggaaacacctactcggaggctcatctcaaacagctcgct
gaattggctaaggaactctccattatggtggtttctgatgaagtttttagatggaccgtc
ttcgggaataacccttttgttccgatgggaaagttttcttccatcgtaccagtggttaca
ctcggatccttatctaagggatggaatgtaccaggatggcgaactggctggctcgcgctg
cacgatctagacggtgtcttcagaaacactaagatattagaagctgccaacgaatttctc
cagataaatgccaaacctccgactgttattcaggcggctatgcctgacattttggagaga
actccaaaacatttcttccttgagaggggaagttttctgaaacataaagttgatattgga
tacgctaagctcaagcacatacctggcctcacttgttacatgaaacccgaagcgtgcacc
tttttatggaccaagctggatatatcgtgctttgctgacattggagacgatcaagagttc
tgcagcaagcttgctatggaagaaaatctcgtcgttttgccagggattgcatttagacag
ccgaactggttgaggcattctatcgacatggagacgccaacagttgaggacgcatttgaa
agattgaagagcttctgtgaacgccattccacaaaaggtggagcttcactcaaaaacgcc
aatggcgtcaactaa

DBGET integrated database retrieval system