KEGG   Raphanus sativus (radish): 108829823
Entry
108829823         CDS       T06014                                 
Name
(RefSeq) cytochrome P450 83B1
  KO
K11818  aromatic aldoxime N-monooxygenase [EC:1.14.14.45]
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz00380  Tryptophan metabolism
rsz00966  Glucosinolate biosynthesis
rsz01100  Metabolic pathways
rsz01110  Biosynthesis of secondary metabolites
rsz01210  2-Oxocarboxylic acid metabolism
Module
rsz_M00370  Glucosinolate biosynthesis, tryptophan => glucobrassicin
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    108829823
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    108829823
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:rsz00199]
    108829823
Enzymes [BR:rsz01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.45  aromatic aldoxime N-monooxygenase
     108829823
Cytochrome P450 [BR:rsz00199]
 Cytochrome P450, plant type
  CYP83 family
   108829823
SSDB
Motif
Pfam: p450 FANCI_S2 Goodbye
Other DBs
NCBI-GeneID: 108829823
NCBI-ProteinID: XP_018458913
UniProt: V5Q6C6
LinkDB
Position
Unknown
AA seq 499 aa
MDLFLIIAAMVAVAAFLLLRSSTKKSLRLPPGPKGLPIIGNLHQMEKFNPQHFLFRLSKL
YGPIFTMKIGGRRLAVISSAELAKELLKTQDLNFTARPLLKGQQTMSYQGRELGFGQYTA
YYREMRKMCMVNLFSPNRVASFRPVREEECQRMMDKIYKAADQSGTVDLSELLLSFTNCV
VCRQAFGKRYNEYGTEMKRFINILYETQALLGTLFFSDLFPYFGFLDNLTGLSARLKRAF
KELDTYLQELLDETLDPNRPKQETESFIDLLMQIYKDQPFSIKFTHENVKAMILDIVVPG
TDTAAAVVVWAMTYLIKYPEAMKKAQDEVRNVVGDKGYVSEEDIPNLPYLKAVIKESLRL
EPVIPILLHRETIADAKIGGYDIPAKTIIQVNAWAVSRDTAAWGDNPNEFIPERFMNEHK
GVDFKGQDFELLPFGSGRRMCPAMHLGVAMVEIPFANLLYRFDWNLPKGIKPEDIKMDVM
TGLAMHKKDHLVLAPRTHI
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggatctcttcttgattattgccgccatggtagcggtcgcagccttcctcctcctccgg
agctccacgaagaaatctctccggctgcctccggggccaaaaggtcttcctattattgga
aacctccaccagatggaaaaatttaacccccaacacttcctttttcgtctctccaagctc
tacggtccaattttcacaatgaaaatcggtggacgccgccttgcagtgatctcatcggcg
gagttagccaaggaactcctcaagacccaggacctcaatttcaccgctcgtcctctcctg
aaggggcaacaaacgatgtcatatcaaggtcgtgagcttggtttcggacagtacacagcg
tactatcgtgagatgaggaagatgtgtatggttaacctattcagcccaaatcgcgtcgca
agtttccgacccgttagagaagaagagtgccaacgtatgatggacaagatctacaaagcc
gctgatcaatcagggaccgttgatttaagtgagcttctcttgtccttcaccaactgtgtc
gtctgtagacaagcttttggtaagcgctacaacgagtacggaaccgagatgaagagattc
ataaacatcttgtacgagactcaagcccttttgggtactctgtttttctccgacctcttc
ccttatttcggatttcttgacaatctcactggtcttagtgcccgtctcaagagagctttc
aaggagctcgacacttaccttcaagaactcctcgacgagactcttgaccctaaccgccct
aaacaagagacagagagtttcattgatcttttgatgcagatctacaaagatcaacctttc
tccatcaaattcacccacgaaaatgtcaaggccatgatattggatattgttgtaccggga
actgacacggcggctgcagtggtggtatgggccatgacttaccttataaagtaccctgaa
gcaatgaagaaagctcaagatgaagtgaggaatgtggtcggtgacaaaggatacgtctcc
gaagaagacatcccaaatctcccttatctgaaggccgtcatcaaggagtcactccgtctc
gaaccagtcatcccaattcttctgcatagagaaaccatagcagacgcaaaaataggtggc
tatgatattccggcgaagaccatcattcaggtgaacgcatgggcggtttctcgtgacaca
gccgcctggggagacaaccctaatgagttcattccagagaggttcatgaacgagcacaaa
ggagtggacttcaaggggcaagattttgagctcctacctttcgggtcgggcagaagaatg
tgccccgctatgcatcttggggtcgcaatggtagagataccttttgctaaccttctctac
cgattcgattggaacctaccaaaagggattaaacctgaggacataaagatggatgtcatg
accggactcgctatgcataagaaagatcacctagtccttgcaccaaggacgcacatttga

DBGET integrated database retrieval system