Rhincodon typus (whale shark): 109915744 Help Entry 109915744         CDS       T06055                                  Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism rtp  Rhincodon typus (whale shark) Pathway rtp04010   MAPK signaling pathway rtp04012   ErbB signaling pathway rtp04068   FoxO signaling pathway rtp04137   Mitophagy - animal rtp04140   Autophagy - animal rtp04144   Endocytosis rtp04150   mTOR signaling pathway rtp04210   Apoptosis rtp04218   Cellular senescence rtp04370   VEGF signaling pathway rtp04371   Apelin signaling pathway rtp04510   Focal adhesion rtp04540   Gap junction rtp04625   C-type lectin receptor signaling pathway rtp04810   Regulation of actin cytoskeleton rtp04910   Insulin signaling pathway rtp04912   GnRH signaling pathway rtp04916   Melanogenesis rtp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:rtp00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109915744    04012 ErbB signaling pathway     109915744    04370 VEGF signaling pathway     109915744    04371 Apelin signaling pathway     109915744    04068 FoxO signaling pathway     109915744    04150 mTOR signaling pathway     109915744  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109915744    04140 Autophagy - animal     109915744    04137 Mitophagy - animal     109915744   09143 Cell growth and death    04210 Apoptosis     109915744    04218 Cellular senescence     109915744   09144 Cellular community - eukaryotes    04510 Focal adhesion     109915744    04540 Gap junction     109915744   09142 Cell motility    04810 Regulation of actin cytoskeleton     109915744  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109915744   09152 Endocrine system    04910 Insulin signaling pathway     109915744    04912 GnRH signaling pathway     109915744    04916 Melanogenesis     109915744  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109915744  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rtp04131]     109915744   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rtp04147]     109915744    04031 GTP-binding proteins [BR:rtp04031]     109915744 Membrane trafficking [BR:rtp04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     109915744  Endocytosis   Macropinocytosis    Ras GTPases     109915744 Exosome [BR:rtp04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109915744   Exosomal proteins of colorectal cancer cells    109915744 GTP-binding proteins [BR:rtp04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     109915744 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  109915744 NCBI-ProteinID:  XP_048463047 LinkDB All DBs Position 17:34419161..34441359 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PSRSVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREISQHKVRKSNPPDDSGQD CNNCKCVIL NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagctggtggtggttggggctggtggcgttgggaagagtgctttaaca attcaactcatccagaatcactttgtggatgaatacgatcctacgatagaggattcctat agaaagcaggtagttattgatggggaaacctgtttgttggatattctggacacagcaggt caagaggagtacagtgccatgagagaccaatacatgaggacaggagaaggcttcctgtgt gtctttgcaatcaacaacaccaaatcatttgaagacattcatcagtacagggaacaaatt aaaagggtgaaggattctgatgatgttccaatggttctggtgggaaacaagtgcgatctg ccttcccgatctgtggagactcggcaggcccaagacctggcccggagttatggcattcct tacatcgaaacttctgccaaaaccagacagggagtggaggatgctttttacactttggtc cgagagatcagccaacacaaagtcaggaaatcaaatccaccagatgacagtgggcaagac tgtaacaactgtaaatgtgtgatattgtga

DBGET integrated database retrieval system