Rhincodon typus (whale shark): 109918192 Help Entry 109918192         CDS       T06055                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism rtp  Rhincodon typus (whale shark) Pathway rtp03082   ATP-dependent chromatin remodeling rtp04217   Necroptosis Brite KEGG Orthology (KO) [BR:rtp00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     109918192  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109918192  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rtp03036]     109918192   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rtp04147]     109918192 Chromosome and associated proteins [BR:rtp03036]  Eukaryotic type   Nucleosome assembly factors    Histones     109918192 Exosome [BR:rtp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109918192 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  109918192 NCBI-ProteinID:  XP_020373678 LinkDB All DBs Position 35:23878552..23879413 Genome browser AA seq 129 aa AA seqDB search MSGRGKTGGKGRAKAKTRSSRAGLQFPVGRIHRLLRKGHYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TGHPSKVYA NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtcaggccgtggtaaaactggagggaaaggtcgtgctaaggccaagacccgctcctcc cgagctggtctccagttcccggtcggtcgtatccaccgcctgttgcgtaaaggacactat gcggagcgggtcggagctggggcccctgtttatctggctgctgtcctcgagtacctgacc gccgagatcctcgaattggctggtaacgcggcccgggataacaaaaaaactcgtattatt ccccgccacctgcagcttgccatccgcaacgatgaggaactcaacaagctgctgggtggg gtcaccatcgcccagggcggcgtcttgcccaacattcaggccgtgctgcttcccaagaaa acgggccaccccagcaaagtttacgcctga

DBGET integrated database retrieval system